KEGG   Rhizobium etli CFN 42: RHE_CH02875Help
Entry
RHE_CH02875       CDS       T00317                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RHE_CH02875
Enzymes [BR:ret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RHE_CH02875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3005318..3006247
Genome map
AA seq 309 aa AA seqDB search
MYSETQWLFVAGASLAYHHAEATGPACGILLISHGLAEHSKRYRRFAETMAARGYHVYAH
DHRGHGETTAPDAPIGRFAQRDGVERVIGDIVAMRAHAASRHPDLKVILFGHSMGGLIAL
NAAVTAPADFDAVAVWNSNFAVGLAGRAAQAILFAERMLKGSDVPSGLLPKLTFAAWGRS
ISNRRTEFDWLSHMPGEVDRYVADPLCGFDASVSLWLDVFELTFRALQKVHLDRLRRDLP
IHLVGGAQDPATERGKAVLWLSNHLKRQGFSRISTEIYQDMRHETLNETRAEAAIAAFAD
WCDGAVGKR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtattccgaaacgcaatggctctttgtggccggagcatcgctggcctatcaccacgcc
gaggcgaccggccccgcctgcgggattctgttgatatcgcatggcctggcggagcactcg
aaacggtatcgccgctttgccgagacgatggcggcgcgcggctatcacgtctatgcccat
gatcaccgaggccatggtgagacgacggcgcccgacgccccgatcggccgcttcgcgcag
cgcgatggcgtcgaacgggtgatcggcgacatcgttgccatgcgcgctcacgcggcctcg
cgccatcccgacctgaaggtcatcctcttcggccattcgatgggcggtctcatcgcgctc
aacgccgccgtcaccgctccggccgacttcgacgcagtcgccgtctggaattctaatttc
gccgtcggtcttgccggccgcgccgcccaggcgatccttttcgccgaacgcatgctgaaa
ggatcggacgtgccgagcggcctcctgccgaaactcactttcgccgcctggggccggtcc
atttccaaccgccgcacggagttcgactggctgtcgcatatgcccggcgaagtcgacaga
tatgtcgccgaccctctttgcggcttcgacgcctcggtttcactctggctcgatgtcttc
gaactgacctttcgcgcactgcaaaaggtccatctcgaccggctgcggcgcgacctgccg
atccatctggtcggcggcgcgcaagatccggcgaccgagcgtggaaaagccgtgctctgg
ctgtcaaaccatttgaaacgccagggtttctcccgtatcagcactgagatatatcaggac
atgcggcacgaaacgctgaatgagacccgcgcagaggcggccattgccgccttcgcggac
tggtgtgacggcgcggtcggcaagcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system