KEGG   Rhizobium etli CFN 42: RHE_CH03122Help
Entry
RHE_CH03122       CDS       T00317                                 

Gene name
glpKch2
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RHE_CH03122 (glpKch2)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RHE_CH03122 (glpKch2)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_CH03122 (glpKch2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3269235..3270728)
Genome map
AA seq 497 aa AA seqDB search
MSGYVLAIDQGTTSTRAIVFDGDMHVAGKGQKEFTQIYPRSGWVEHDPEEIWDSVVSTVQ
MAPRDAEVAAKDIAALGITNQRETVVVWERETGRPIQNAIVWQDRRTASYCDNLKRQDLE
RLFTKKTGLILDPYFSGTKLSWMLANVKGARTRAARGDLCFGTIDTFLIWRLTGGKSFVT
DATNASRTLMYNIAENAWDEDLLDILRVPAAMLPEVRDCAADFGTVDPEIFGAAIPILGV
AGDQQAATIGQACFAPGMLKSTYGTGCFALLNTGADMVRSKNRLLTTIAYRLDGETTYAL
EGSIFIAGAAVQWLRDGVGIIGSAAETNALAERADPTQEVYLVPAFTGLGAPHWDAKARG
AIFGLTRNTGPAELSRAALEAVCFQTRDLLDAMQKDWKNSGDDTVLRVDGGMVASDWTMQ
RLADLLDAPVDRPMILETTALGAAWLAGSRAGVWPDKEDFSTTWKRDRRFEPDMDEKVRA
AKLKGWRSAVRRTLSEG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatatgttctggcgatcgatcagggaacgacgtcgacgcgggcgatcgttttc
gatggcgacatgcacgtcgccggcaagggccagaaggaattcacgcagatctatcctcgc
tcgggctgggtcgaacacgatccagaggaaatctgggattcggtcgtctccacggtccag
atggcgccgcgcgatgcggaagttgcggccaaggatattgccgcgctcggcatcaccaac
cagcgcgagacggtggtcgtctgggagcgggagacgggtcggccgatccagaatgccatc
gtctggcaggaccgacgcaccgcaagctattgcgacaatctgaaacggcaggatctcgaa
cggctgttcaccaagaagaccggcctgatcctcgatccctatttttccggtacgaagctt
tcttggatgctcgccaacgtcaagggcgcccggacgcgtgccgccaggggtgacctctgc
ttcggtacgatcgacacctttctcatctggcggctgaccggcggcaagagcttcgtcacc
gacgccacaaatgcgtcgcgcacgctgatgtacaacattgccgaaaacgcctgggacgag
gatttgctcgacattctgagagtgccggccgccatgctgccggaggtcagggattgcgcc
gccgatttcggcacggtcgatcctgagattttcggcgctgcgatcccgatcctcggggtt
gccggcgaccagcaggcggcaaccatcggtcaagcatgttttgccccgggcatgctgaaa
tcgacttacggcaccggctgcttcgcgctgctcaacaccggcgccgacatggtgcgttca
aaaaaccgactgctgacaaccatcgcctatcgcttggacggtgagacgacgtatgcgctc
gagggatcgatcttcatcgcaggtgctgcggtgcaatggctgcgggatggagtagggatc
atcggcagcgccgccgagaccaatgcacttgccgagcgggcagatccgacacaggaggtc
tacctcgtgcccgccttcaccggcctcggtgcaccgcattgggatgccaaggcgcgtggc
gccatcttcgggctgacgcgcaacaccggcccggcagagctctcgcgggccgcgctcgag
gccgtctgttttcagacccgcgatctgctcgacgcgatgcagaaggattggaagaatagc
ggcgacgacactgtcctgcgtgtcgatggcggcatggtcgcttccgactggacgatgcag
cggctcgccgacctgctcgacgccccggtcgaccgccccatgatcctggagacgacggcg
ctgggtgcggcctggctcgccgggagtcgggcaggggtctggccggacaaggaagatttt
tccacgacgtggaaacgggaccggcggtttgagcccgatatggatgagaaggtgcgggcg
gcaaaactcaaaggctggcggagtgcggtccggcggaccctgagcgaggggtga

DBGET integrated database retrieval system