KEGG   Rhizobium etli CFN 42: RHE_CH03123Help
Entry
RHE_CH03123       CDS       T00317                                 

Gene name
bdhA
Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase protein
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00072  Synthesis and degradation of ketone bodies
ret00650  Butanoate metabolism
ret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RHE_CH03123 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RHE_CH03123 (bdhA)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RHE_CH03123 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABC91889
RhizoBase: RHE_CH03123
UniProt: Q2K5J7
Position
3270886..3271662
Genome map
AA seq 258 aa AA seqDB search
MSRSVVVTGSTSGIGLAIATAFAETGDNIVINGFGNADEIKAIVARLESVSKARAIYHPA
DMTKPAEIADLIETAAKTFGSVDVLVNNAGIQHVEKIEDFPIEKWDQIIAINLSSSFHTM
RAAIPLMKAKKRGRIINIASAHGLVASPFKSAYVAAKHGILGLTKTAALELAEFGVTVNA
ICPGYVLTPLVEKQIPDTARARGMTEEQVKSEVILKAQPTREFVKAGEIGALSLYLASEA
ARQVTGTHISIDGGWTAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcagatcagtcgtcgtcaccggttccaccagcggcatcggcctcgcgatcgccacc
gccttcgccgaaaccggcgacaacatcgtcatcaatggtttcggaaacgccgatgaaatc
aaggcgatcgtcgcgcggcttgaatcagtgtcgaaggcccgggcgatctaccacccggcc
gatatgacgaagccggcggagattgccgatctgatcgaaacggcggcaaagactttcggc
agcgtcgatgtgctggtcaacaatgccggcattcagcatgtcgagaagattgaggatttc
ccgatcgagaaatgggaccagatcatcgccatcaatctgtcgagctcctttcacaccatg
cgcgccgccattccgctgatgaaggcgaagaagcgcggccgcatcatcaacatcgcctcc
gcccatggcctcgtcgcctcgcccttcaaatccgcctatgttgcggcaaaacatggtata
ttgggcctgacgaagacggcagccctggaacttgccgaattcggcgtgacggtcaacgcc
atctgccccggctacgtgctgacgccgctcgtcgagaagcagataccggataccgccagg
gcccgcggcatgaccgaggaacaggtgaagagcgaggtcatcctcaaggcgcagcccacg
cgtgaattcgtcaaggccggggaaatcggcgcgctgtcgctctacctcgccagcgaagcc
gcccggcaggtgaccggaacgcacatctcgattgacggtggctggacggcagcctaa

DBGET integrated database retrieval system