KEGG   Rhizobium etli CFN 42: RHE_CH03212Help
Entry
RHE_CH03212       CDS       T00317                                 

Gene name
pssT1
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ret  Rhizobium etli CFN 42
Brite
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     RHE_CH03212 (pssT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3373935..3375008
Genome map
AA seq 357 aa AA seqDB search
MNRRRFLASIPLALLCAGAGQALAQVPPSAGLRALADRKSFRFGSAIDPEDVGNSIASQM
YIDNVNSITPRNQLKWNATEKMPGVFSFGPADQVVGFARRNNMRVYGHTLVWYRTPDWVS
AINDAETIRAAMNRHIKQVVGRYKGSIDAWDVVNEPLEYDVPDLRDCVFRRLLGDDYIRM
SFDMAHEANPDAMLVLNETHLEKKSDVFEQKRVRILKIVEDLVARKTPIGAVGLQSHFRP
GLDRIDPEGMGRFCAALKDMGVGVFITELDASCHFLDRGKVPTPVSYAEVFGDVITIAAE
RGDLKGATVWGMSEKYGELDEKDTNPGAACTKRVNLYDENNDPRSSIDGIKRAIEAM
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaagacgtttcctcgcctccattccgctcgccctgttatgtgccggcgcgggt
caggctttggcccaggtgccgccgtccgcggggctgcgcgcccttgccgacagaaaatcg
tttcgattcggttcggcgatcgatccggaggatgtcggcaattcgattgcgtcgcaaatg
tacatcgacaacgtcaattcgataacgccgcgaaaccagctgaagtggaatgcaacggaa
aagatgccaggcgtcttttccttcggccccgccgatcaagtcgttgggtttgcacgcaga
aataacatgagggtttatggacacacgcttgtctggtatcgcacgcccgactgggtgtcc
gccatcaacgacgctgagaccattcgggcggcgatgaaccgtcatataaaacaagttgtc
ggtcggtataaggggtcgatcgatgcgtgggatgtggtgaacgagccgttggaatatgat
gtgccggatctgcgggactgcgttttccgacgccttcttggcgacgactatatccgcatg
agcttcgacatggcacacgaggccaatcccgatgcgatgctggttctcaacgagacgcac
ttggagaaaaaatccgacgtgttcgaacagaagcgtgtgcgcatcctgaagattgtcgag
gatctcgtcgccagaaagacgccgatcggcgccgtcgggctgcaatcgcatttccgcccc
ggtctcgatcggatcgatccggagggaatgggccgattctgtgcggcgctgaaggatatg
ggtgtcggggtttttatcacggaactcgatgcgtcctgtcacttcctcgaccgcggcaag
gtccccacgccggtctcctatgccgaggttttcggtgacgtgatcaccatcgcagccgag
cgtggtgacttgaaaggcgccaccgtttggggcatgtcggagaaatatggcgagcttgac
gagaaggacaccaatcccggcgcggcatgcacgaagcgcgttaatctttacgacgaaaac
aacgatccgagaagttcgattgacggcatcaagcgggcaatagaggcaatgtga

DBGET integrated database retrieval system