KEGG   Rhizobium etli CFN 42: RHE_CH03327Help
Entry
RHE_CH03327       CDS       T00317                                 

Gene name
pssB
Definition
exopolysaccharide production protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ret  Rhizobium etli CFN 42
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ret00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3493124..3493921
Genome map
AA seq 265 aa AA seqDB search
MLTTFEKAALEAGKAIIAVLREGFPIAMKADASPVTVADEEAERIILAHLSRDYPDIPIV
AEESVAAGNVPDISGRSFFLVDPLDGTREFVDGRQEFTVNIAYIENGAPVAGIVYAPALG
LAFSGERSRAERLEVTENFTIGARTAIAVREQLDDRLALASLRHNSPETGTFLADHAISR
CTNIGSSLKFCLLAEGKADVYPRFTRTMEWDTAAGDAVLRAAGGSTVTLDGALLTYGKTG
TAADFDFANPNFISWGGRKRVLEPA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgacatttgaaaaggcagcgctcgaagccggtaaggccatcatcgcggttttg
cgcgaaggctttcccattgccatgaaggcggacgcaagcccggttacggttgccgacgag
gaggccgaacgcatcatcctcgcccatctctccagggattatcccgatatacccatcgtg
gcagaagagtcggttgccgccggaaacgtgcccgacatcagcggccgaagcttcttcctg
gtcgaccctctcgacggcacccgtgaattcgtcgacggacggcaggaattcaccgtcaac
atcgcctatatcgagaacggcgccccagtcgccggcatcgtctacgcgccggccctcggg
ctcgccttctcgggggagcgcagccgtgccgaaaggcttgaggtcaccgagaacttcacc
atcggggcacgcacagcaattgccgtgcgcgagcagttggacgatcggcttgcacttgca
agccttcgtcacaacagcccggagacgggaaccttcctcgccgatcacgcgatctccaga
tgcaccaatatcggctcctcgctgaagttctgcctgctggccgaaggcaaggccgacgtc
tatccacgcttcacccgcacgatggaatgggacaccgcggccggcgacgcagtgctgcgc
gctgccgggggatcgacggtgacgctcgacggggcgctgctgacctatggcaagacgggg
acggcggccgatttcgactttgccaatccgaacttcatctcctggggcggcaggaaacgc
gtcctcgaaccggcgtga

DBGET integrated database retrieval system