KEGG   Rhizobium etli CFN 42: RHE_CH03420Help
Entry
RHE_CH03420       CDS       T00317                                 

Gene name
adeC2
Definition
(GenBank) adenine deaminase protein (EC:3.5.4.2)
  KO
K01486  
adenine deaminase [EC:3.5.4.2]
Organism
ret  Rhizobium etli CFN 42
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RHE_CH03420 (adeC2)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     RHE_CH03420 (adeC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
3596457..3598244
Genome map
AA seq 595 aa AA seqDB search
MNAIARQEPFDLNDPALRARAVAAARGDAPFDMLITGGRLLDAVTGLIREADIGLVGALI
ASVHAPASRTDAVEIIDATGGILTPGLIDMHMHVESSMVTPAEYASAVLPHGVTTVVWDP
HEFGNVQGLDGVRWAIEAARTLPLRMILLAPSCVPSAPGLELAGADFDAAVIAEMLRSPA
VGGVAEVMNMRGVIDGDPRMSAIVNSGLASGKLVCGHARGLTGADLNAFMAAGVTSDHEL
TSGADLAAKLSAGLTIELRGSHDHLLQEFVEVLNGLGHLPATVTLCTDDVFPDELYQSGG
LDEVARRLVRYGMKPEWALRAATFNAAQRLKRSDLGLVASGRRADLVLFEDLTELRARLV
ISDGRIVARNGSMEAAVQPLDTAPLINSTKLPPLTESDFRVPAKGARVRIATIDRPRFTQ
WGEAETEIRDGFVVPPAGSAMIAVAHRHGKAGGTPRIGFLTGWGEWRGAFCTTVSHDSHN
LTVFGGDARDMALAANAVIKAGGGLAVAKDGAIQAILPLPLSGLVTDASLKDTASAFSDI
RKAMDKIVDWKPPYRVFKACFGATLACNAGPHQTDRGIADVTTGKVLESPVLEIF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccattgctcgtcaagaacctttcgatctcaacgatccagccttgcgcgcccgg
gccgttgccgccgcccgcggcgatgccccattcgatatgctcatcaccggcggccggctg
ctcgatgcggtgacgggtttgatccgagaagccgacatcggcctcgtcggcgcgctcatc
gccagcgtccatgccccggcgagccgcacggacgcggtcgaaatcatcgatgcgaccggc
ggcatcctgacgccgggcctgatcgacatgcatatgcatgtcgaaagctcgatggtgacg
ccggcggaatatgcaagcgccgtgctgccgcacggcgtcacgacggtcgtctgggatccg
catgaattcggcaacgtccagggcctcgacggcgtacgctgggcgatcgaggcggcgcgc
accctgcctctgcgcatgatcctgctcgctccctcctgtgtaccttcggcgccgggcctg
gaacttgccggcgccgatttcgatgccgccgtcatcgccgaaatgctgcgttcgcctgcc
gtcggcggcgttgccgaagtcatgaacatgcgcggcgtcatcgacggcgatccgcgcatg
agcgccatcgtcaactcaggccttgcctccggcaagctcgtctgtggccatgcccgcggc
ctcaccggcgcggacctcaacgccttcatggcagcgggcgtcacctccgaccacgaactc
acctccggcgccgatctcgccgccaagctttccgctggcctgacgatcgagctgcgcggc
tctcacgatcatctcttgcaggaattcgtcgaggtgctgaacggtctcggccacctgccc
gccaccgttacgctttgcacagacgacgtctttcccgatgaactctaccaaagcggcggc
ctcgatgaggtcgcccgccgcttggtgcgctacggcatgaaaccggaatgggccctgcgc
gccgcgaccttcaacgccgctcagcggctgaaacggtccgatctcggccttgtcgcctcc
ggccgccgcgccgatctcgttctcttcgaggatctcacggaattgcgagcacgcctcgtc
atatcagacggccgcatcgtcgcccgcaacggcagcatggaggcggccgttcaaccgctc
gatacggcaccgctcatcaactccaccaagctaccgccgctgacggagagtgatttccgc
gtccctgcgaagggcgcacgcgtccgcatcgccaccatcgaccgcccgcgcttcacgcaa
tggggcgaagccgaaaccgagatccgagacggcttcgtcgtgccgccggccgggagcgcc
atgatcgccgtcgcccatcgccacggaaaggccgggggcactccgcgcatcggctttctc
accggctggggcgaatggcgcggcgccttctgcaccaccgtctcgcatgatagccacaac
ctcaccgtcttcggcggcgatgcgcgcgacatggcgctcgccgccaacgccgtcatcaaa
gccggcggcggcctggcggtcgccaaggacggcgcaatccaggcgatcctgccgctgccg
ctctccggcttggtcaccgacgcatcgctgaaagacacggcttcggccttttccgatatc
cgcaaggccatggacaaaatcgtcgactggaaaccgccctaccgcgtcttcaaggcctgc
ttcggcgcaacgctggcctgcaatgccggtccgcaccagacggaccgggggattgcggat
gtgacgacaggaaaggtgctggaaagtcccgtcttggaaattttctag

DBGET integrated database retrieval system