KEGG   Rhizobium etli CFN 42: RHE_CH03572Help
Entry
RHE_CH03572       CDS       T00317                                 

Gene name
pldB
Definition
lysophospholipase L2 protein (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RHE_CH03572 (pldB)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RHE_CH03572 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3766840..3767814
Genome map
AA seq 324 aa AA seqDB search
MDQVLYSTPDNPVPENRTEGFFETYDGHRLRYAVFRSGGQVAKGTVVIIHGRNEYIEKYF
ETIRDLTGQGLWVATFDLRGQGGSSRLLKRRNHGHIRRFADYERDLDTFLEKIVLPDTRL
PFYLLGHSTGGLIALSAAPYLTTRIDRMVLSAPFIGLTGQSASPRVIRTLAGALTAAGLG
FMPLTSKLKEPDFRDNPLTSDETRFERNVAMMKAHPELTLGPPTARWLTEAFRTMDRVTS
PNHLFSITIPTIVIAPTRDGVVPYTAQERLSRYFRAGQLVPINGARHEIFQERDIYRAAA
LAAFHAFIPGSDAEENHDVAALGT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggttctctattcgacgcccgataatcccgtcccggaaaaccgcaccgaaggg
ttcttcgaaacctatgacggccaccggctgcgttacgccgttttccgctccggtggccag
gtcgccaagggcacggtcgtcattatccatggccgcaacgaatatatcgaaaaatatttc
gagacgatccgcgacctgacaggccagggcctctgggtcgcgacgttcgacctgcgtggc
caaggcggttcgtcgcggctcctgaagcgccgcaatcacggccatatccgccgctttgcc
gattacgagcgcgacctcgacaccttcctcgaaaagatagtactgccggatacccgcctg
cccttctacctgctcggccattccaccggcggactgatcgcgctgtcggccgccccctat
ctcaccacccgcatcgaccgtatggtgctatcggctcccttcatcggcctgaccggccag
tcggcctcgccccgcgtcatccgcaccctcgccggcgcgctgacggccgccggcctcggc
ttcatgccgctgacctcgaagctgaaggagccggatttccgcgacaatccgttgacctct
gacgaaacccgcttcgagcgcaatgttgcgatgatgaaggcccatccggaactaacgctc
gggcctccgacggcccgctggctgaccgaagccttccggaccatggaccgggtcacctcg
cccaaccatctcttctcaatcaccatcccgaccatcgtcatcgccccgacacgtgatggc
gtcgtgccctacacggcacaagagcggctctcgcgctatttccgcgccggccagctggtg
ccgatcaacggcgcccgccatgagatcttccaggaacgggatatctatcgcgccgcggcg
ctggcggccttccacgccttcatccccggcagcgatgccgaggaaaaccatgatgtcgcc
gccctcggcacctga

DBGET integrated database retrieval system