KEGG   Rhizobium etli CFN 42: RHE_CH03594Help
Entry
RHE_CH03594       CDS       T00317                                 

Gene name
glgBch
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ret  Rhizobium etli CFN 42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHE_CH03594 (glgBch)
Enzymes [BR:ret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RHE_CH03594 (glgBch)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_CH03594 (glgBch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3796309..3798516
Genome map
AA seq 735 aa AA seqDB search
MKTPKTLPEVTLSWEISADEITAILAGSHSNPFAVLGVHQGGDAFVARCFIPGAEEVTAM
TLDGGFIGELKQLHADGVFAGPVSLAKLQPVRYRARRGDAEWAVTDPYSFGPVLGPMDDY
FAREGSHLRLFDKMGAHLIKHEGAQGIHFAVWAPNAQRVSVVGDFNGWDGRRHVMRFRAD
SGIWEIFAPDVPLGVAYKFEIRGHDGVLLPLKADPFARRSELRPKTASIAAAELEQVWED
EAHLKHWRETDKRRQPISIYEVHAGSWQRRQDGTMLSWDELASSLIPYCVDMGFTHIEFL
PITEHPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHG
LGWFDGTALYEHEDPRKGFHPDWNTAIYNFGRTEVVSYLVNNALYWAEKFHLDGLRVDAV
ASMLYLDYSRKHGEWIPNEYGGNENLEAVRFLQDLNIRIYGQHSNVMTIAEESTSWPKVS
QPVHEGGLGFGFKWNMGFMHDTLSYMKRDPVHRKHHHNELTFGLLYAYSENFVLPLSHDE
VVHGKGSLIAKMPGDDWQKFANLRAYYAYMWGYPGKKLLFMGQEFAQWSEWSEAKSLDWN
LLQYRMHEGMRRLVRDLNFTYRSKPALHERDCEGEGFEWLVADDHQNSVFAWLRKAPGQK
PVAVITNFTPVYRENYTIRLPSAGRWREILNTDADIYGGSGKGNGGRVQAVDAGGDITCS
ITLPPLATIMLEPEN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgccgaaaaccctccctgaagtaacactttcctgggaaatttcggcagatgaa
atcacggcgatccttgccggctcgcattccaatccctttgccgtcctaggggtgcaccaa
ggcggcgacgctttcgttgcccggtgcttcatcccgggtgcggaggaagtgaccgccatg
acgctcgatggcggttttatcggcgaactgaagcaactccatgccgatggcgtcttcgcc
gggccggtttcgctcgccaaactgcagccggtgcgctaccgcgcccggcgcggcgacgcc
gaatgggcggtcaccgatccctacagcttcgggccggtgctcgggccgatggacgattat
ttcgcccgcgaaggttcgcatctgcgcttgttcgataagatgggtgctcatctcatcaag
cacgaaggcgcccagggcatccacttcgcggtctgggcgccgaacgcccagcgcgtctcc
gtggtcggcgatttcaacggctgggacggccgccgccatgtcatgcgcttccgcgccgac
agcggcatctgggaaattttcgctcccgatgtgccgctcggcgtcgcctacaaattcgag
atccgcggccacgacggcgtgttgctgccgctgaaggctgatcccttcgcccgccgcagc
gagctcagaccgaagaccgcctcgatcgccgctgccgagctggagcaggtctgggaggat
gaggcccatctgaagcactggcgcgaaaccgacaagcgccgtcagccgatctcgatctat
gaagtgcatgccggctcctggcagcgccggcaggacggcaccatgctgtcctgggacgag
ctcgcctccagtctcatcccctattgcgtcgacatgggtttcacccatatcgaattcctg
ccgattacagagcatccctacgacccctcttggggctaccagacgacaggtctttacgcg
ccgaccgcccgcttcggcgagccggaaggcttcgcccgtttcgtcaacggctgtcacaag
gtcggtatcggcgtcattctcgactgggtaccggcacatttcccgaccgacgaacacggc
ctcggctggtttgatggcaccgcgctctacgagcacgaagacccgcgcaagggcttccat
cccgactggaacacggcgatctataacttcggccgcaccgaggtggtttcctatctggtc
aacaacgccctctattgggccgagaagttccatcttgacggcctgcgcgtcgatgccgtc
gcctcgatgctctatctcgattattcccgcaagcatggcgaatggatcccgaacgaatat
ggcggcaacgagaacctcgaagctgtccgctttctgcaggacctcaacatccgcatctat
ggccagcattccaacgtcatgaccatcgccgaggaatcgacctcctggccgaaagtctcg
caacctgtgcatgaaggcggcctcggcttcggcttcaaatggaacatgggcttcatgcat
gacacgctgagctacatgaagcgcgacccggtgcaccgcaagcaccaccataatgaactc
accttcggcctcctctacgcctattcagaaaatttcgtcctgccgctgtcgcacgacgag
gtcgttcacggaaagggctcgctgatcgccaagatgccgggcgacgactggcagaagttc
gccaatctgcgcgcctactacgcttatatgtggggctatcccggtaagaagttgttgttc
atggggcaggaattcgcccagtggagcgagtggagcgaggcgaagtcgctcgactggaac
ctgttgcaataccgcatgcacgagggcatgcggcgcctggtgcgcgacctcaacttcacc
tatcgcagcaagccggcgctgcatgagcgtgactgcgagggcgagggttttgaatggctg
gttgccgacgaccaccagaattccgtctttgcctggctgcgcaaggcgccgggccagaag
ccggtcgccgtcatcaccaatttcacccccgtctaccgcgagaactacacgatccgcctg
ccgtcagcaggccgctggcgggagatcctgaacaccgatgccgacatttacggcggcagc
ggcaagggcaatggcgggcgcgtgcaggccgtcgatgccggcggcgacatcacctgctcg
atcacgctgccgcccctggcgacaatcatgcttgaacctgaaaattaa

DBGET integrated database retrieval system