KEGG   Rhizobium etli CFN 42: RHE_CH03648Help
Entry
RHE_CH03648       CDS       T00317                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ret  Rhizobium etli CFN 42
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ret00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ret00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3861345..3862655)
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIQKIKYEGPDSTNPLAFRYYQPDEIVLGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFLRPWFEDTMKAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGKNFAENTKNLNE
IVDYFAEKQAATGTKLLWGTANLFSNRRYMSGAATNPDPDVFAFAAATVKTCIDATQKLG
GENYVLWGGREGYETLLNTDLKRELDQLGRFLNLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKKHGLENEVKVNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKTGGTNFDSKLRRQSLDPADLLIGHIGGMD
CCARGLKAAAKMIEDKALSQPLADRYAGWESVEAQKLFRGEYSLDEIANWVESKDVNPQP
KSGKQELLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggatttttcggcgatatccagaagatcaaatatgaaggtcctgacagcacc
aatccgctcgccttccgctattaccagccggacgagatcgttcttggcaagcgtatggaa
gaccatctgcgttttgcggtggcctattggcacaccttcacctggccgggtggcgacccc
ttcggcggccagaccttcctgcgtccgtggttcgaagacacgatgaaggctgccaagctc
aaggccgatgtcgctttcgaattcttctcgctgctcggcgcgccctattactgcttccac
gacgccgacgtgcgccccgaaggcaagaatttcgctgaaaacaccaagaacctcaacgag
atcgtcgattacttcgccgagaagcaagcggcgaccggcaccaagctgctctggggtacg
gcgaacctgttctccaaccgccgctacatgtcgggtgcggcgaccaaccccgatccagac
gtctttgctttcgccgccgcgacggtcaagacctgcatcgacgccacgcagaagctcggc
ggcgagaactacgtgctctggggcggacgcgaaggttacgagacgctgctcaacaccgat
ctcaagcgcgaactcgatcagctcggccgcttcctcaacctcgttgtcgaatacaagcac
aagatcggcttcaagggcaccatcctgatcgagccgaagccgcaggagccgaccaagcac
cagtatgactatgacgtcgcgaccgtttacggcttcctcaagaagcacggccttgaaaac
gaggtgaaggtcaatatcgagcaggggcatgcgatcctcgccggccactctttcgaacac
gagttggcgctcgccaatgcgctcggcatcttcggctcgatcgacatgaaccgcaacgac
taccagtccggctgggacaccgaccagttcccgaacaatgttccggaaatggctcttgcc
tattaccacgttctagcgggcggcggcttcaagaccggcggcaccaacttcgactcgaag
ctgcgccgccagtcgctcgatccggcagacctcttaatcggtcatatcgggggcatggac
tgctgcgcccgcggcctcaaggcggcggccaagatgatcgaggacaaggccctgtcgcag
ccgcttgccgaccgttatgccggttgggaatcggtcgaggcgcagaaactcttccgcggc
gagtattcgctggatgagatcgcgaactgggtcgagagcaaggacgtcaacccgcagccg
aaatccggcaagcaagaactgctcgaaaacgtcgtcaaccgttacgtctga

DBGET integrated database retrieval system