KEGG   Rhizobium etli CFN 42: RHE_CH03851Help
Entry
RHE_CH03851       CDS       T00317                                 

Gene name
argI
Definition
(GenBank) arginase protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00220  Arginine biosynthesis
ret00330  Arginine and proline metabolism
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01130  Biosynthesis of antibiotics
ret01230  Biosynthesis of amino acids
Module
ret_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    RHE_CH03851 (argI)
   00330 Arginine and proline metabolism
    RHE_CH03851 (argI)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     RHE_CH03851 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABC92598
RhizoBase: RHE_CH03851
UniProt: Q2K3I8
Position
4081285..4082220
Genome map
AA seq 311 aa AA seqDB search
MNVQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIDLGHDVADNGDLGIVPAMD
LPNHPKAHNLRIVGAFTRALESSVHDVAAAGRFPLILGGDHSLSMGSVSGMARYAASKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKNVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIGAIVRDILDVVAKADGLLHVSLDVDFLDPEIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccaatcgcgatctgtcaccctcatcggcgcaccattggaagagggctccggc
cgcagaggcgctgccatgggccctgcggcgctgcgcattgccggtgtcgaccagacgctg
atcgatctcggccacgatgtcgccgataatggcgatctcggtatcgtgccggcgatggat
ctgccgaatcatccgaaagcccacaatctgaggatcgtcggcgccttcacccgcgcgctc
gaaagcagcgtccacgacgtcgccgccgccggccgttttccgctcattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccagcaaaggccgc
ccactcttcgtgctctggctcgatgcccatgccgatttcaactctccggccacctcgccc
tccggcaatattcacggcatgcctgtcgccttcttctgcggcgaggcggagttcgccgaa
atcctgccgaaggaccgtcccttcgtcgatccgaaaaatgtcttccaggtcggcattcgt
tccgtcgatgcgcgcgaacgcgaggaaatccatgaacatggcgtcaacgtcttcgatatg
cgcgccatcgacgagcagggcatcggcgccatcgtgcgggacattctcgacgtcgtcgcc
aaggcggacggcctgctgcatgtcagcctcgatgtcgatttcctcgatcccgagattgcc
cccggcgtcggcacgacggtgcccggcggcgcgacgttccgcgaggcgcatcttgtcatg
gaaatgctgtctgacagcggccttgtgtcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgcggcaagagcgcccgcatcctggtggagttgacggcaagcctcttcggc
cgccgcatcttcgatcgtccaacccgtgccgcatag

DBGET integrated database retrieval system