KEGG   Rhizobium etli CFN 42: RHE_CH03887Help
Entry
RHE_CH03887       CDS       T00317                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ret  Rhizobium etli CFN 42
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:ret01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ret00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ret00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4117799..4119055)
Genome map
AA seq 418 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPVSGTLSEIV
AAAGETVGPGALLGQIAEGAGAAAAAPAAAAPAAAPSQAVPAAAAQPAAAASSSSASVST
MPPAPAAAKMLAESNLSADQVDGSGKRGQVLKGDVIAAVAKGISAPAAAPAAAPAAARGP
STVEDASREERVKMTRLRQTIAKRLKDAQNTAAMLTTYNEVDMKAVMDLRNKYKDIFEKK
HGVKLGFMGFFTKAVTHALKELPAVNAEIDGTDVIYKNYCHVGMAVGTDKGLVVPVIRDA
DQMSIAEIEKDLGRLAKAARDGSLSMADMQGGTFTITNGGVYGSLMSSPILNAPQSGILG
MHKIQERPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaaatccgcgttccaactctcggtgaatccgtcagcgaggcaaccgtcggc
acctggttcaagaaggtcggcgacgccatcaaggccgacgagccaattctggagcttgaa
accgacaaggtgaccatcgaagttcccgcgcccgtctccggtacgctgtcggaaatcgtc
gcggccgccggcgagactgtcggtcccggtgcactgctcggccagatcgccgaaggtgcc
ggtgctgccgccgctgcgccggctgctgctgcaccggccgccgctccctcccaagcggtc
cccgctgccgcggcccagccggctgctgctgcatcgtcttcgagcgcttccgtctccacc
atgccgccggcaccggcggctgcgaagatgctggccgaaagcaatctttccgccgatcag
gtcgacggcagcggcaaacgcggccaggtgctgaagggcgatgtcatcgctgccgtcgcc
aagggcatttccgctcccgccgcggcaccggctgcagcgcctgcggctgcacgtggtccg
tcgacggtcgaggatgcctcgcgcgaagagcgggtgaagatgacgcgcctgcgccagacg
atcgccaagcgcctcaaggacgcgcagaacaccgccgccatgctgaccacctataacgag
gtggacatgaaggcggtcatggacctgcgcaacaagtacaaggacattttcgagaaaaaa
catggcgtcaagctcggcttcatgggtttcttcaccaaggcggtgacgcatgcgctgaag
gagctgccggcggtcaatgccgagatcgacggcaccgacgtcatctataagaattactgc
catgtcggcatggccgtcggcaccgacaagggtctcgtcgttcctgtcatccgcgacgcc
gaccagatgtcgatcgccgaaatcgagaaggacctcggccgtcttgccaaggcagctcgt
gacggctcgctctccatggccgacatgcagggcggcaccttcaccatcaccaatggcggc
gtttacggctcccttatgtcctcgccgatcctcaacgcaccgcagtcgggcattctcggc
atgcacaagatccaggaacggccggttgcaatcggcggccaggtggtcatccgtccgatg
atgtatctggcgctttcctacgatcaccgcatcgtcgacggcaaggaagcggtcaccttc
ctcgtgcgcgtcaaggagagcctcgaagatccggaacgcctggttctcgatctctaa

DBGET integrated database retrieval system