KEGG   Rhizobium etli CFN 42: RHE_CH03905Help
Entry
RHE_CH03905       CDS       T00317                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ret  Rhizobium etli CFN 42
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ret00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4136747..4137454
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPAHSATRTAQRLRDMGHEPLLLPLRRPQHDSAAAAGALAATHGAIAVTSGEAA
RVLSALGETLPPHLDRPVFAVGERTAQAAQRLGFRSVTASSGNGRDLADLVGAQRVEDLL
YLAGRPRAEIFEGRLRELGIRFSVAECYRMLPVAPGPADIESIFSGHRPDAVLFYSRQTA
EDFFQVAELRSALSEQGGIRLLCLSEAVAQAIPTFLKETVAISSMPDEISLLSLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgctcgtcacccgccccgcgcattcggcgacaagaacagcacaacgtctgcgc
gatatgggtcacgagcctctgctgctgccgctgcgtcgaccacaacatgacagtgccgct
gccgccggtgcgcttgcagccacgcacggcgcgatcgcggtaaccagcggcgaagccgcc
agggtgctgtcggctctcggcgagacacttcctccgcaccttgaccgcccggttttcgcg
gtcggcgagaggacggcgcaagcggcgcagcggcttggcttccggtcggtcaccgcatct
tcgggcaacggccgcgatctcgccgatctcgtcggcgcgcagagggtggaagacctgctt
tacctcgccggcaggccgcgcgccgaaatcttcgaagggagattgcgcgaactcgggatc
cgcttttccgtcgccgaatgttatcgcatgctgccggtcgctcccggcccggccgacatc
gagtcgattttttccggccatcgcccggatgccgtgcttttctattcccggcaaacagcg
gaggatttctttcaggtggcagagctgcgatcggccctgtcggaacagggcggaatccgc
cttctctgcctgagcgaggcggtagcgcaggccattccgaccttcctgaaagagaccgtg
gcgatttcgtcgatgccggatgagataagccttttgtcgctgctttga

DBGET integrated database retrieval system