KEGG   Rhizobium etli CFN 42: RHE_PB00026Help
Entry
RHE_PB00026       CDS       T00317                                 

Gene name
glpKb
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RHE_PB00026 (glpKb)
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RHE_PB00026 (glpKb)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_PB00026 (glpKb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_b: 
RhizoBase: 
UniProt: 
Position
p42b:27241..28743
Genome map
AA seq 500 aa AA seqDB search
MSGYILSIDQGTTSSRAIIFNSDMKMAGSAQAEITQYYPQPGWVEHDAAEIWQSVVDTMR
KAIAGAGVDAAAIAAVGITNQRETAVVWDRKSGTPLYRAIVWQDRRTAEMCESLKADGYE
KLFSAKTGLLLDPYFSGTKLRWLLDNVDGLREQAEAGEVCFGTIDSWLIYKLTGGRVHAT
DATNASRTLLYNIDDGTWDEELLGILGIPAAMLPEVRECADDFGRVDEALFGAALPIFGV
AGDQQAAAMGNACFEPGMMKSTYGTGCFALLNTGQDRVSSANRMLTTIACRLDGETTYAL
EGSIFIAGAAVQWLRDGLGIIGQASEAGVLAAKADPGQQVYIVPAFTGLGAPYWDPAARG
AIFGLTRNSGPAEFARAVLESVAYQTLDLLVAMKRDWGANQLETVLRVDGGMAASDWTMQ
CLADMTGNPVDRSAIHETTALGAAWLAGSRAGIWPGKREFAKAWACDRRFSPAMAETERQ
AKIIGWKNAVSRMISDASAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctatattctttcgattgatcagggcacgacgtcttcgcgtgcgatcatcttc
aacagcgacatgaaaatggccggatccgctcaggcggagatcacgcaatactatccgcag
cccggctgggtggagcacgatgctgccgaaatctggcagtccgtcgtcgacacgatgcgc
aaggcgatcgctggtgccggcgtggatgccgccgcgatcgcagccgtcggcatcaccaac
cagcgcgaaacggcagtcgtctgggaccgcaagtccggaacaccgctttaccgcgcgatc
gtctggcaggaccggcgcacggcggaaatgtgcgaaagcctgaaggccgatggatatgag
aagctgttttccgccaagaccggcctgctgctcgacccatacttttcgggaaccaagcta
cgctggctgctcgacaatgtcgatgggctgcgcgagcaggccgaggcgggcgaggtctgt
ttcggcacgatcgacagctggttgatctacaagctgaccggcggccgcgtgcatgcgacc
gatgcaaccaatgcatcgcgaaccctgctctacaatatcgatgacggaacctgggacgag
gaactgctcggcattctcggcatcccggccgccatgcttcccgaggtcagggaatgcgcc
gatgatttcggccgggtcgacgaggccctgttcggggccgcgctgccgatcttcggggtc
gccggcgaccagcaggcggcggcgatgggcaatgcctgcttcgaacccggcatgatgaaa
tcgacttacggcaccggctgcttcgccctgctcaacacaggccaggatcgagtctcctcc
gccaatcggatgctgacgaccatcgcctgccgcctcgacggcgagacgacctatgcgctc
gaaggctcgatcttcatcgccggtgccgccgtgcaatggctgcgcgacggcctcggcatt
atcggccaggcgtcggaggcaggggtgcttgcggccaaggccgatcctgggcagcaggtc
tatatcgtccccgccttcaccgggctcggcgcgccttattgggatccggctgcgcgtggt
gcgatcttcggcctgacgcgcaacagcggaccggcggaatttgcccgcgccgtgctcgaa
tccgttgcctatcagacactcgacctgcttgtggctatgaagagggattggggcgccaac
cagctggagacggtgttgcgcgtcgatggcggcatggcggcttccgattggacgatgcaa
tgcctcgccgacatgaccggaaacccggtcgaccgctcggcgatccacgagacgacggcg
ctcggggccgcctggcttgccggctccagggccggtatttggccgggcaagcgtgaattt
gccaaggcttgggcctgtgatcgacgtttcagccccgcaatggcggagacagagcggcag
gccaagatcatcggttggaagaatgccgtgtcgcggatgatctcggacgcttcggcggga
tag

DBGET integrated database retrieval system