KEGG   Rhizobium etli CFN 42: RHE_PB00029Help
Entry
RHE_PB00029       CDS       T00317                                 

Definition
(GenBank) probable iron alcohol dehydrogenase protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00010  Glycolysis / Gluconeogenesis
ret00071  Fatty acid degradation
ret00350  Tyrosine metabolism
ret00625  Chloroalkane and chloroalkene degradation
ret00626  Naphthalene degradation
ret01100  Metabolic pathways
ret01110  Biosynthesis of secondary metabolites
ret01120  Microbial metabolism in diverse environments
ret01130  Biosynthesis of antibiotics
ret01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PB00029
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_PB00029
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHE_PB00029
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHE_PB00029
   00626 Naphthalene degradation
    RHE_PB00029
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHE_PB00029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABC93073
UNAM_b: RE1PB0000029
RhizoBase: RHE_PB00029
UniProt: Q2K1V8
Position
p42b:complement(30898..32031)
Genome map
AA seq 377 aa AA seqDB search
MASLDSPITIVRPHLIEFGIGTAAKLGKWAAEKGFRRTLIISDAFNAARIDLLELKGEMT
VFAEVTPEPDTANLEKVLQAANGADAELIVGFGGGSAMDLAKLAAVLAGSAQTLHDVVGP
NKVHGPRKAALAQVPTTSGTGSEAGIRALVTDPRTMAKLAVESLHMLADIAVIDPALTFS
VPARTTAATGVDAMAHCVEAFTNRKAHPMVDIYAIEGTRLVGKYLARAVRDGNDAEARAG
LSLASLYGGFCLGPVNTAGGHALAYPLGTRWHVAHGAANALIFPHVLAFNTPSAPEKTKA
VMEALGRHTSENSASVFDAAYAFCAELGIEMKLSGLGVPESDLDAMTEDAFAIRRLLDNN
PRDLTRADIRSIYAAAL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcttggattcgccaatcacgatcgttcggccgcatctgatcgagttcggcatc
ggcacggcggcaaagctcggcaaatgggctgccgaaaagggtttcagacgcacgctcatc
atctccgacgctttcaatgccgcgcgcatcgacctgctggaattgaagggcgagatgacg
gtctttgccgaagtgacgcccgagccggatacggccaacctcgaaaaggtgctgcaggcg
gccaacggcgccgacgccgaactgatcgtcggcttcggcggcggcagcgccatggatctg
gcaaaactcgccgccgttcttgccggctccgcacagacgctgcatgacgtcgtcggcccg
aacaaggtgcacgggccgcgcaaggcagcgctcgcccaggtgccgacaacatcgggcacc
ggcagtgaggcgggcatccgcgcgctcgtcaccgaccccaggaccatggcgaagctcgct
gtcgaaagcctgcatatgctggccgacatcgccgtcatcgatccggcgctcaccttcagc
gtgccggcacgcacgacggccgccaccggcgtcgacgccatggcccactgcgtcgaggcc
ttcaccaaccgcaaggctcatccaatggtcgatatctatgcgatcgagggaacgcggctg
gtcggcaaatatctcgcccgcgccgtcagagacggcaacgacgccgaagcgcgcgccggc
ctgtcgctcgcctcgctttatggcggcttctgcctcggcccggtcaacaccgccggcggc
catgcgctcgcctacccgctcggcacgcgctggcatgtggcgcatggcgctgccaatgcg
ctgatattcccgcatgttctcgccttcaacacgccgtctgcgcctgagaagacgaaagcg
gtgatggaggcgcttgggcgccatacctcggaaaactcagcatccgtcttcgatgcggcc
tatgctttctgcgccgaactcggcatcgagatgaaactgtcagggcttggcgtgccggaa
agcgatctcgacgccatgaccgaggacgcttttgccatccggcgcctgctggacaacaat
ccgcgtgacctcacgcgtgccgacattcgctcgatttacgcagccgccctttag

DBGET integrated database retrieval system