KEGG   Rhizobium etli CFN 42: RHE_PC00098Help
Entry
RHE_PC00098       CDS       T00317                                 

Definition
(GenBank) probable ribokinase protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RHE_PC00098
Enzymes [BR:ret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RHE_PC00098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABC93305
UNAM_c: RE1PC0000098
RhizoBase: RHE_PC00098
UniProt: Q2K1E5
Position
p42c:complement(104788..105714)
Genome map
AA seq 308 aa AA seqDB search
MSEKSGIVILGIFAADTAYKAKRLPHIAETLMGSGFTLGPGGKGSNQAIAAAKAGGKVTF
ISRVGNDAFGAMALGAYAEAGVKANVMQMEGVSTGAAFIFVDEVSGDNAIIVVPGAAGLI
GIEDVEVNRAAIESAALFMTQLEQPLEAALHGLSIAKRAGATTIFNPAPASAIPNSIYGL
CDFIVPNEVEAAELVGHAIGTDEQARAAARTLVDRGAKAAVITLGARGALYHAAGQSEFV
PAFSAGNVIDTTGAGDAFLGGFATAISEGRAPIEAVRFGCATAAIAVTRPGTAPAMPSRA
EISALLGS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaaagcgggatcgtcattttaggcatttttgccgccgacaccgcctataag
gcaaagcgcctgccccatattgccgagacgctgatgggatcgggtttcaccctcgggccg
ggaggcaagggctccaaccaggcgattgccgcggcaaaggcaggcggcaaggtgactttc
atttcacgggtgggcaacgacgcgttcggcgcgatggcccttggggcctatgcggaggcg
ggcgttaaagccaatgtgatgcagatggaaggcgtttccacgggtgccgccttcatcttc
gtcgacgaggtgagcggcgacaacgccatcatcgtggtgcctggcgccgcggggctgatc
ggcatcgaagatgtcgaagtgaaccgggcggcgatcgaaagcgcggctcttttcatgaca
cagctcgaacagccgctggaagcggccttgcacggcctgtcgatagccaagagggctggg
gcaacgacaatcttcaacccggccccggccagcgccatcccgaacagcatctatggcttg
tgcgatttcatcgttcccaatgaagtcgaagcggcggagttggtgggtcatgcgatcgga
accgacgagcaggcacgcgcagcggcgcgcacgctggtcgatcggggcgcgaaagcagcg
gtcatcacgctcggcgcccgcggcgcactctatcacgccgccgggcagagcgaattcgtc
cccgcattttcggccggaaatgtcatcgacacaaccggtgccggggacgcctttctcggt
gggttcgcgacggcgatttccgaaggccgggcgccaatcgaggccgtccgtttcggctgc
gcgaccgccgcgatcgcggtaacacggccgggcacggctcccgccatgccttctcgcgcc
gagatcagcgccttgctgggctcctga

DBGET integrated database retrieval system