KEGG   Rhizobium etli CFN 42: RHE_PC00105Help
Entry
RHE_PC00105       CDS       T00317                                 

Gene name
adhA1
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHE_PC00105 (adhA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PC00105 (adhA1)
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_PC00105 (adhA1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHE_PC00105 (adhA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHE_PC00105 (adhA1)
   00626 Naphthalene degradation
    RHE_PC00105 (adhA1)
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHE_PC00105 (adhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_c: 
RhizoBase: 
UniProt: 
Position
p42c:complement(112590..113489)
Genome map
AA seq 299 aa AA seqDB search
MLRMEACAVCRTDLHVCDGDLDNPKLPLVPGHEIVGIVEAVGEGIASSRIGQRVGVPWLG
HACGSCSFCRAGEENLCDRPQFTGYTRDGGFATHVVADADYAFALDAQADPVALAPLLCA
GLIGWRSLKKAGDGARIGLYGFGAAAHIIAQICRWQGREVYAFSRAGDVAARRFALSLGA
VWAGSSDESPPVMLDAAIIFAPVGALVPAALKVVRKGGRVVCGGIHMSDVPAMPYALIWG
ERSVVSVANLTRGDAEEFFPVARQAGVRTHTTVYPLSDANRALDDLRAGRLSGAAVLTP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaatggaggcctgcgccgtctgccggaccgaccttcacgtctgtgacggcgat
cttgacaaccccaagctcccgctcgttcccggccacgagatcgtcggcatcgtcgaggcg
gtcggggaggggatcgcctcgtcgcggattggacaaagggtcggcgtaccatggcttggc
cacgcttgcggatcctgttccttttgtcgggccggagaggaaaacctctgcgaccggccg
cagttcaccggctatacgcgcgacggcggctttgccacccatgtcgtcgcggatgccgac
tatgccttcgcgctggacgctcaggctgatcctgtcgctcttgccccgctgctctgcgcc
ggtctcataggatggcgttcattgaagaaggctggcgacggcgctaggatcgggctctac
gggttcggtgcggccgctcatatcatcgcccaaatctgccgctggcagggccgtgaggtc
tatgcgttctcgagagcaggcgatgttgcggcgcgccgttttgccctcagcctcggcgct
gtctgggcgggaagctccgatgaaagcccgccggtcatgctggatgcggccatcatcttc
gctccggtcggagcgctcgtgccggcggccttgaaagtcgtgcgcaagggcggcagggtc
gtctgcggaggcatccatatgagcgacgttccggcgatgccctatgccttgatctggggc
gagcgaagcgtcgtctcggtcgcaaacctcacgcgtggcgacgcggaggaattctttccc
gtcgcccgtcaggcaggcgtcaggacccacacgaccgtctatccgcttagcgacgccaac
cgggcgctcgacgatctgcgtgccggccggttgagcggggcagcggtgctgacaccgtaa

DBGET integrated database retrieval system