KEGG   Rhizobium etli CFN 42: RHE_PC00119Help
Entry
RHE_PC00119       CDS       T00317                                 

Definition
(GenBank) probable glutathione-independent formaldehyde dehydrogenase protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ret  Rhizobium etli CFN 42
Pathway
ret00625  Chloroalkane and chloroalkene degradation
ret00680  Methane metabolism
ret01100  Metabolic pathways
ret01120  Microbial metabolism in diverse environments
ret01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    RHE_PC00119
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHE_PC00119
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     RHE_PC00119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C GIDA
Motif
Other DBs
NCBI-ProteinID: ABC93325
UNAM_c: RE1PC0000119
RhizoBase: RHE_PC00119
UniProt: Q2K1G4
Position
p42c:complement(125700..126890)
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLILGHEITGEIIEKGVDVEMLQIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPARA
GGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIRDLTMLSDILPTGFHGAV
RAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKDRLAHAAKVGFEPIDLSKS
DRLGDMIAEVVGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGNLSLRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHDRLPIADIVN
AKVIPLDDAAAGYESFDHGAATKYVLDPHGEVAKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaatagaggcgtcgtctatctccggccgggaaaggtcgaagtccgcgatatc
gacgatccgaaactggaagcgcccgatggccgccgcatcgagcacggcgtgatcctgaag
gttatctccaccaatatctgcggctccgaccagcacatggtccgcggccgcacgactgca
atgccgggcctaatcctcggccatgaaatcaccggcgagatcatcgagaaaggcgtcgac
gtcgagatgctccaaatcggcgacatcgtctcggtgcccttcaacgtcgcctgcggccgc
tgccgctgctgcaaatcccaggatacgggcgtctgcctgacggtaaatccggcccgcgcc
ggcggcgcttacggctatgtcgacatgggcggatggatcggcgggcaggcacgctacgtc
accattccctatgccgatttcaacctgctgaaaatcccggatcgggataaggcgatggcg
aagatccgcgatctcaccatgctttccgacattctgcccaccggctttcacggtgcagtg
cgcgcgggcgtcggggtcggctcgaccgtctatgtcgccggcgccggtcctgtcgggtta
gcggctgcggcttcggctcgcatcctcggtgccgccgtcgtcatgatcggcgatttcaac
aaggaccgcctggcgcatgccgcgaaggtcggtttcgaacccatcgatctttccaagagc
gatcgtctcggcgacatgattgccgaggtcgtcggcagcaacgaggtcgacagcgccatc
gacgcggtaggattcgaagcacgcggccattccggcggcgaacagccggcgatcgtgctc
aaccagatgatggagatcacccgcgccgcaggctcgatcggcatccccggcctctacgtg
accgaggacccgggcgcggtcgacaatgccgccaagcacggcaatctctcgcttcgcttc
ggtctcggctgggcaaaagcacaatccttccacaccggccagactccggtgctcaaatat
aatcgccagctcatgcaggcgattctccacgaccggttgccgatcgccgatatcgtcaac
gctaaggtcatcccgctcgacgatgccgccgctggatatgaaagtttcgaccatggcgcg
gcaacgaagtatgtcctcgatccgcacggcgaggtcgcgaaagccgcctga

DBGET integrated database retrieval system