KEGG   Rhizobium etli CFN 42: RHE_PC00128Help
Entry
RHE_PC00128       CDS       T00317                                 

Definition
acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_PC00128
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PC00128
   00620 Pyruvate metabolism
    RHE_PC00128
   00640 Propanoate metabolism
    RHE_PC00128
  Energy metabolism
   00680 Methane metabolism
    RHE_PC00128
Enzymes [BR:ret01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RHE_PC00128
Lipid biosynthesis proteins [BR:ret01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RHE_PC00128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_c: 
RhizoBase: 
UniProt: 
Position
p42c:134729..136783
Genome map
AA seq 684 aa AA seqDB search
MTSKPLDRLLRPQTIAVFGGREARRVIEQCDRMGFSGQIWPVHPKLEEVLGRPCYRSVSD
LPSAPDAAFVGVNRTLTVEIVRSLSDAGAGGAVCYASGFSEATAELADGTELQQALMEAA
GDMPILGPNCYGLINGLDGALLWPDQHGMKRIERGVAILTQSSNIALNLTMQTRGLPIAY
MVTAGNQAQTSLADIASALMEDQRVTAIGLHVEGFGDLAALERLAAIARRLKKAVVVLKV
GRSEQAKHAAVSHTASLAGSDAVADAMLTRLGLGRVQSLPALLETLKLLHIAGPLPSHSI
SSMSCSGGEASLMADAAVGREVEFPALQPQQLPRLRQVLGDMVALSNPLDYHTFVWGDFE
RQAEAFRAMFEGGYALNLVVLDFPRGDRCDAAEWATTVDAVIAAASATGTLAGLLATLPE
NMPEPIADRLMANGIIAFSGIDEAIIAAEAAAGIGKVWDRPPPLPLLDVPSMDGEIETLT
EADAKTELAACGLPVPWGLQAFSPREAAEQAERLGFPVVLKGLGIAHKTEAGAVVLNLRD
PEAVSNAAAAMPANGGYLIEKMIDPPVAELIVGATRDPVFGLSLTLGAGGIFVELLDDSI
VLPLPATKAEIRDALLGLKIAKVIHGYRGRPRGDLDAAVDAVAAAAEYVVKNAVRLEELD
LNPLMVLPEGRGVVAVDALIRRRR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaaaccgctcgaccgcctgctcagacctcaaacgatcgccgtcttcggcggt
cgcgaggcgcgcagggtgatcgagcaatgcgaccgcatgggcttttcgggccagatctgg
cccgtccatcccaaactcgaggaggtgcttggacggccgtgttatcgctctgtatccgat
ctgccttctgccccggacgctgctttcgtgggtgtcaacaggacgctgacggtcgagatc
gtgcgcagcctttcagacgccggcgccggtggagcggtctgctatgcatcgggcttcagc
gaggcgacggcggaacttgccgacggcaccgaactgcagcaggcccttatggaggcggcg
ggtgacatgccaatccttgggccgaactgctacgggctgatcaacggtctcgatggcgcc
ctgttatggcccgaccagcacggcatgaaacgcatcgaacgcggcgtcgcgatcctcaca
caatcctccaatatcgccctcaacctcaccatgcagacccgcgggctgccgatcgcctat
atggtcactgcgggcaaccaggcgcagacatcgcttgccgatatcgccagcgcgctgatg
gaggatcagcgggtcacggcgatcggtcttcatgtcgagggtttcggcgacctcgcggcc
ctagaacgccttgcagccatcgcccgccggttgaagaaggcggtcgtcgtgctgaaggtc
ggcaggtccgagcaggcgaaacacgcggccgtatcccacaccgcctcgctcgccggcagc
gacgcggtggcggatgccatgctcacccgtctcggtctcggccgtgtccagagcctgccg
gcgctgcttgaaaccctaaaattactgcatatcgccggccctctcccgagccattcgatc
tcgtccatgagctgctccggcggcgaggcttcgctgatggcggatgccgccgtcggccgc
gaggtggaattcccggcgctgcagccacaacaattgccgcgtctgcgtcaggtcctcggc
gatatggtggcgctttcaaatccgctcgactaccacaccttcgtctggggcgatttcgaa
cgccaggccgaagccttcagagccatgttcgaaggcggttatgccctcaatctcgtcgtt
ctcgacttcccgcgtggcgaccgctgcgatgcggccgaatgggcgacgacggtggatgcg
gtgatcgccgccgcctctgccaccggtacactggccggccttctcgcaacccttccggag
aatatgccggagccgatcgccgatcgtctcatggcgaatggcatcatcgccttttcgggc
atcgacgaagccattattgcggcggaagccgccgccggtattggcaaggtctgggatcgc
ccgcctcccctgccgctgctcgacgtgccgtccatggacggcgaaatcgagacgctgacg
gaagccgacgcgaagacggaacttgctgcctgcggcctccctgttccctgggggctgcag
gctttttctcctcgcgaagccgccgagcaggccgagcggctcggttttcccgtcgtgctg
aagggtctcggcattgcgcacaagaccgaggccggcgctgtcgttctcaacctcagagat
ccggaggcggtgtcaaatgcggcggcagcgatgccggcgaatggcggttacctcatcgag
aagatgatcgatccgccggtcgccgagctcattgtcggggctacccgcgatcctgtattc
ggtttgtcgctcaccttgggagctggcggaatattcgtcgaactgcttgacgattccatc
gttttgccgctgcccgcaacaaaggccgaaattcgcgacgcgcttttgggcctcaagatt
gctaaggtgatccatggctatcgtgggcggccgaggggtgatctcgacgccgccgtagac
gctgtcgcagctgcggcagaatatgtcgtaaaaaatgcggtgcgcctggaggaactggac
cttaatccgttgatggttctgcccgaagggcgcggtgttgttgcagttgatgctctcata
cgccgaaggaggtag

DBGET integrated database retrieval system