KEGG   Rhizobium etli CFN 42: RHE_PD00076Help
Entry
RHE_PD00076       CDS       T00317                                 

Definition
monophenol monooxygenase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHE_PD00076
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RHE_PD00076
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     RHE_PD00076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
p42d:84667..86496
Genome map
AA seq 609 aa AA seqDB search
MPWLVGKPSLERSWNAILSFPESGFQLECRNTIGSSVFSSHFTLHFRVARRLLHFSCRRF
TETQKEPTQALWWCELPTAPAPRRRGTGLKAALILAKDNSNPRESKMSITRRHVIVQGGV
IAAGLLASGLPGTKAFAQIPSIPWRRSLQGLAWNDPIIETYRDAVRLLNALPASDKFNWV
NLSKIHGSGDVVKYCPHGNWYFLPWHRAYTAMYERIVRHVTKNNDFAMPFWDWTDNPYLP
EVFTMQKTPDGKDNPLYVSSRTWPITQPMPDNIVGPQVLNTILTAKPYEVFGTTRPEGQN
SLDPSWVTTSSGTQGALEYTPHNQVHNNIGGWMPEMSSPRDPIFFMHHCNIDRIWATWNL
RNANSTDRLWADMPFTDNFYDVDGNFWSPKVSDLYVPEELGYNYGFRTYFKVAAASAKTL
ALNDKLTSVIAATATDAAIAGVTTTSTDNSKAATENVPLSLPIKIPAGALQEIVRQPPLP
SGMDTMDFGAAQEQAASAPRVLAFLRDVEITSASTTSVRVFLGKNDLKADTPVTDPHYVG
SFAVLGHDGDHHRKPSFVLDLTDAIQRVYGGRGQTDGEAIDLQLIPVGSGAGKPGAVEPA
KLEIAIVSA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtggctggtcggcaagccgtcgctcgaacgatcatggaatgcgatactaagtttt
ccggaatctggattccaactggaatgcaggaatacgatcggtagtagcgtttttagctcg
cattttacgctgcattttcgagtggcacgtcgcttgcttcatttctcgtgccgccgattc
accgaaactcagaaagagccaacgcaagctctatggtggtgcgaattgcccactgctccc
gcgcccagacggcgcggaaccggcctaaaagcggcattaatcttggcgaaggacaattca
aatccaagggagagtaagatgagcatcacacgcagacatgtcatcgttcagggtggcgtc
attgcagcaggcctgctcgccagcggcctaccggggacaaaagccttcgcgcagataccg
tcaatcccttggcggcgctcactgcagggcttggcctggaacgacccgatcatcgagacc
tatcgcgacgcagtgcgccttctcaacgcccttcccgccagcgacaaattcaactgggtc
aacctctcgaaaattcacggcagcggtgacgtcgtcaaatactgcccgcatggcaactgg
tatttcctgccgtggcacagggcctatacggctatgtacgagcgcatcgttcggcacgtg
accaagaacaacgatttcgctatgccgttctgggactggaccgacaatccgtacctgccc
gaagtgttcacaatgcaaaagacgcccgacggcaaggacaatccactttatgtttcgtcg
cgcacctggccaatcacgcagccgatgccggacaatatagttgggccacaggttctcaac
accatcctaacggcgaagccatacgaggtcttcggcaccacccgccccgagggacagaac
tcactcgatccttcctgggtcaccaccagcagcggcacgcagggggcgctggaatacaca
ccgcacaatcaggtgcacaacaatatcggtggctggatgccggaaatgtcgtcgccccgc
gatccgatcttcttcatgcatcattgcaacatcgaccgcatctgggcgacctggaatttg
cgcaacgccaacagcacggatcgactctgggccgacatgccgttcaccgacaatttctac
gatgtcgacggcaacttctggtccccgaaggtctctgacctttatgttccagaggaactc
ggatacaattatggtttccggacctacttcaaggtcgcggcggcgagcgccaaaacgctg
gccctgaacgataaactcacgtccgtgatcgcggcgacggcgaccgatgctgcaatcgcc
ggcgtgacgaccacctccacggacaacagcaaggcggcaacggaaaacgtgccgctttcg
ctgccgatcaagatcccggcgggcgcattgcaggagatcgtccgccaaccgcctctgcca
tccggcatggatacaatggatttcggcgcggcacaggagcaggcggcctccgctcctcgt
gtgctggcattcctgcgcgatgtcgagatcaccagtgccagcacgaccagcgttcgggtg
tttctcggcaagaacgaccttaaggccgatacgcccgtcaccgatccccattacgtcggt
tctttcgccgttctcggtcatgacggcgaccatcatcgcaaaccatccttcgtcctcgat
ctgacggacgcgatccagcgggtttacggcggaagggggcagacggatggcgaggccatc
gacctgcagctcattcctgtcggatcgggagcgggcaaacccggcgccgtagagcccgca
aagctagaaatagccatagtgtccgcctaa

DBGET integrated database retrieval system