KEGG   Rhizobium etli CFN 42: RHE_PD00127Help
Entry
RHE_PD00127       CDS       T00317                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_PD00127
   01230 Biosynthesis of amino acids
    RHE_PD00127
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PD00127
  Energy metabolism
   00680 Methane metabolism
    RHE_PD00127
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RHE_PD00127
Enzymes [BR:ret01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RHE_PD00127
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RHE_PD00127
  Exosomal proteins of melanoma cells
   RHE_PD00127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
p42d:complement(142846..143475)
Genome map
AA seq 209 aa AA seqDB search
MSTLVIVRHGQSEGNARGEFTGTSDVPLTQEGWSESRRAGSLLANLGISFDIAFSSALLR
TVDTCRAILNETNGDLLEPIRRTELNERDYGQLTGINKNVARERWGQDVVQVWRRSYSTP
PPGGESIRDISARVLPFLISEVFPPLLRGKSVLVVAHGNTIRSLKQGIERLTIQDTLAIE
SPTAAPTVYRIASDLSIIEKTNVLVGTVC
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctggtgattgtccggcatggccaaagcgaagggaacgcgcgcggggagttc
acgggtacgagcgacgtgccgctcacacaggagggctggtctgagagcaggcgagccggc
tcactgctcgcgaacctcggcatctcgttcgatattgcgtttagttctgccctcttgcgc
acagtcgacacttgcagagcgattttgaacgaaaccaacggcgatctgctggagccaatc
aggagaaccgagttgaacgaacgcgactacggacagctcaccggcatcaacaagaacgtg
gcacgtgagcggtggggccaggatgttgtccaggtttggcgccgctcgtacagcactcca
ccacctgggggagaaagcatacgggacataagcgcgagggttctgccctttttgataagc
gaagtgttcccccccttgttgagagggaaatcggttcttgtggtggcccacgggaatacg
atcaggtcactaaagcagggcatcgaacgcctcacgatccaggatacgctcgctattgag
tcaccgaccgccgcgccaactgtataccggattgcgtcggacctctcgatcatcgagaag
actaacgtcctggttggtactgtctgttaa

DBGET integrated database retrieval system