KEGG   Rhizobium etli CFN 42: RHE_PE00089Help
Entry
RHE_PE00089       CDS       T00317                                 

Gene name
agaL1
Definition
alpha-galactosidase (EC:3.2.1.86)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ret  Rhizobium etli CFN 42
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RHE_PE00089 (agaL1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    RHE_PE00089 (agaL1)
   00600 Sphingolipid metabolism
    RHE_PE00089 (agaL1)
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RHE_PE00089 (agaL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_e: 
RhizoBase: 
UniProt: 
Position
p42e:101481..102947
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFRDVEFALTDLSEHNLEMIKAILDRIVESNKL
PTKVTATTNRRQALEGARYIISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSVRELDYICSGINHQTWFIDLRLNGRKIGKDELVAAFEAHPVYSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPEEITRWIDMSDWIHGETGGYLRHSTETRNWFETE
FPQFLESASKPIDPAKRSNEHASHILEGLETNRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVSGVTLPEACAATCIASINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAQARWLPQYADAVPAAKERLSKSKVQTRDWAGAARRNVRSIEELRAE
KAALRQAV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctatcatcggtgcgggcagcgtcggtttcaccaagaagctgttc
accgacatattgtgcgttccggagttccgcgacgtcgaattcgcgctgaccgatctcagc
gaacacaatctcgaaatgatcaaggcgatcctcgaccgcatcgtcgagtcgaacaagctg
ccgaccaaggtaacggcgaccaccaaccggcgccaggcgctggaaggcgcgcgctatatc
atcagctgtgtccgcgttggcgggctcgaggcctatgccgacgatatcagaattccgctg
aaatacggcatcgaccagtgcgtcggcgatacgatctgcgccggcggcattctctacggc
cagcgcaacatccccgtcattctcgatttctgcaaagatatcagggaggtcgccgagccc
ggcgcgaaattcctgaactatgccaatccgatggcaatgaacacctgggcggcgatcgaa
tatggcaaggtcgacaccgttggcctctgccatggtgtccagcacggggccgaacagata
gcggaagtgctcggcgccaagtcggtgcgcgagctcgactatatctgctccggcatcaac
caccagacctggttcatcgatctgcgcctcaacggccgtaagatcggtaaggacgaactg
gtcgccgccttcgaggcacatcctgtttattcgcagcaggagaaactgcgcatcgacgtg
ctgaagcgcttcggcgtctattccaccgaaagcaacggccacctctccgaatacctgccc
tggtaccgcaagcggccggaagaaatcacccgctggatcgacatgtccgattggatccac
ggcgagaccggcggctatctccgccactccaccgagacgcgcaactggttcgagacggaa
ttcccgcagttcctcgaatctgcctccaagccgatcgatcccgccaagcgttccaacgaa
catgcgagccatattctggaagggctggagaccaaccgggtctatcgcggccatttcaac
gtcaagaacaacggcgtcatcaccaacctgccagccgatgcgatcatcgaatcgcccggc
ttcgtcgatcgcttcggcattaacatggtctcaggcgtcaccctgccggaagcctgtgcg
gcgacctgcatcgcctcgatcaacgtccagcgcatgtcggtgcatgccgccatatcgggc
gacatcgacctgttgaagcttgccgtgctgcacgatccgctggtcggcgccgtctcgacg
cccgaggaagtctggcagatggtcgacgagatggtcgttgcccaggcgcgctggttgccg
caatatgccgatgccgtgccggccgccaaggagcggctgtcgaaatccaaggtgcagacc
cgcgactgggcaggggccgcacgccgcaacgtccgctcgatcgaagagctgcgcgcggaa
aaggcggcgctgagacaggccgtctga

DBGET integrated database retrieval system