KEGG   Rhizobium etli CFN 42: RHE_PE00391Help
Entry
RHE_PE00391       CDS       T00317                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ret  Rhizobium etli CFN 42
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RHE_PE00391
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RHE_PE00391
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RHE_PE00391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_e: 
RhizoBase: 
UniProt: 
Position
p42e:complement(429651..431321)
Genome map
AA seq 556 aa AA seqDB search
MLGVEPTRSSVSNAALKRGAEIYPVPANAPVQISVIPWPNHVTVASRRPLPAGFAPQARS
SEGEAAAKGFAALVDHLFAVEGIVRSEAEGAVPVILKDAAGFGPEAYRLSFDEDTLTVEA
SGRTGFLYGLVTLGQIWRGARLHPGVFQFPASGEIVDEPAMGWRGLHLDVARQFYGVAEV
KKLLAVLAWNKLNRFHWHLSDDEAWRVEIDAYPALTEIGAWRGHGLAVPPLLGSSPTRTG
GYYTKSVIREIVAHAKSFGIEIVPEIDMPGHCYAMQQAIPELRDPAEKGSYYSVQGFPDN
CINPAREQTYEIVETILAELIELFPFKVIHLGADEVPLGAWSGSPAALARLRDVAGEAVA
DAHAKRLNVVTNRHGADDIHGSGAAILQAEFLERVQRFLASKGCITGGWEEAAHGDVIDK
EKSYLCSWRNVEVSAELAERGYQMVVCPGQVYYLDMALRPDWDEPGASWAGNSDAEKLYK
FDPLSGWTAAQKQKLLGIQACIWSEPMTDRAVFDRLVFPRISGLAETGWTKPSAKSWDRF
KALAGLMPLLYGLQES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcgtcgagccgacgcgctcttcggtcagcaacgcagcgctgaagcgcggcgcc
gagatctatcccgttcccgccaacgcgcccgttcagatttcggtcattccctggccgaac
catgtcacggtcgcctcgcgccggccgctgccggccggttttgccccgcaggcgcggagc
agcgaaggggaggcggcggcgaaaggcttcgcggcgttggtcgaccatctcttcgccgtc
gaaggcatcgtgcgcagcgaggcggaaggcgcagtgccggtcatcctgaaagatgccgcc
ggcttcggccccgaagcctatcggctgagcttcgacgaggacaccctgacggtcgaggcg
agcggccgcaccggctttctctacggcctcgtcacgctcggccagatctggcgcggcgcc
aggctgcatcccggcgtcttccagtttcccgcatccggcgagatcgtcgacgagccagcg
atgggctggcgcggcctgcatctcgatgtcgcccgccagttctatggcgtcgccgaggtc
aagaagctgctggcggtgcttgcctggaacaagctcaaccgcttccactggcacctttcc
gacgacgaagcctggcgcgtcgagatcgacgcctatcccgccctgaccgagatcggcgcc
tggcgcggccacggccttgccgtgccgccgctgctgggatcgagcccgacccgaaccggc
ggctactacaccaagtcagtcatccgcgagatcgtcgcccatgcgaagagcttcggcatc
gagatcgtgcccgagatcgatatgcccggccattgctacgccatgcagcaggcgatcccg
gagctgcgcgatccggccgagaagggcagctactactcggtccagggctttcccgacaat
tgcatcaatccggcccgcgagcagacctacgagatcgtcgagacgatccttgccgaactg
atcgagctctttccgttcaaggttatccatctcggcgctgacgaggtgccgctcggcgca
tggtcgggctcgccggcagcgctcgcacgcctgcgtgatgtcgccggcgaggcggttgcc
gatgcccatgccaagcggctgaacgtcgtcaccaacaggcatggcgccgacgatatccac
ggctccggcgcggcgatcctgcaggcggaattcctggagcgcgttcagcgtttcctggcg
agcaagggctgcatcaccggcggctgggaggaggcggcccacggcgacgtcatcgacaag
gagaagagctatctctgcagctggcgcaatgtcgaggtctcggccgagctcgccgaacgc
ggctatcaaatggtcgtctgccccggccaggtctattacctcgacatggcgctgaggccc
gattgggacgagccgggcgccagctgggcggggaattcggacgcggaaaagctctataag
ttcgatccgctcagtggctggacggcggcgcagaagcagaagctgctcggcatccaggcc
tgcatctggtcggaaccgatgacggaccgcgccgtcttcgaccgtctcgtcttcccgcgc
atctcggggcttgccgaaaccggctggacgaaaccatccgccaagtcatgggaccgcttc
aaggcgctcgctgggctgatgccgctgctttacgggctgcaggaatcttga

DBGET integrated database retrieval system