KEGG   Rhizobium etli CFN 42: RHE_PF00040Help
Entry
RHE_PF00040       CDS       T00317                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RHE_PF00040 (tpiA)
   01230 Biosynthesis of amino acids
    RHE_PF00040 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PF00040 (tpiA)
   00051 Fructose and mannose metabolism
    RHE_PF00040 (tpiA)
   00562 Inositol phosphate metabolism
    RHE_PF00040 (tpiA)
Enzymes [BR:ret01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RHE_PF00040 (tpiA)
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RHE_PF00040 (tpiA)
  Exosomal proteins of bladder cancer cells
   RHE_PF00040 (tpiA)
  Exosomal proteins of melanoma cells
   RHE_PF00040 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:complement(40874..41677)
Genome map
AA seq 267 aa AA seqDB search
MVVWVGTSFKMNKTLEEALAFARRLADADLERDPRVQRFVIPSFTAVREVKRVLTESSVK
VGAQNMHWEDAGAWTGEISPLMLKDCRLDLVELGHSERREHFGETDETVGLKAAAAIRHG
LTPLICIGETLQERNEGRADAVLRRQVEAALRGVDTEAGEAPILLAYEPVWAIGVNGIPA
TADYASERHRGIAEVAKSILGRPVPVLYGGSVNPGNCEELIGQPDIDGLFIGRSAWSVEG
YLDILARVSAAIDRSSPRQTASERKLP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtctgggtcggcaccagcttcaagatgaacaagacgcttgaggaagcgctcgcc
ttcgcgcgccgcctcgccgatgcggatcttgaacgcgatccccgcgtgcagcgcttcgtc
atcccctccttcacggcggtgcgcgaggtcaagcgtgtactgaccgaaagctcggtgaag
gttggcgcgcagaacatgcattgggaggatgccggcgcctggaccggcgagatttcgccg
ctgatgctgaaggactgccggctcgatctcgtcgagctcggccattccgagcggcgcgaa
catttcggcgagaccgacgagaccgtcggcctcaaggctgccgccgcgatccgccacggc
ctgacgccgctgatctgcatcggcgagaccctgcaggaacgcaacgagggccgggccgac
gccgtgctgcggcggcaggtcgaggccgccctgcggggtgtcgacaccgaggccggggag
gctccgatcctgcttgcctacgagccggtctgggcgatcggcgtcaacggcattccggcg
acggccgattatgcctccgagcggcacagagggatcgccgaagtggcgaaatccattctc
ggccgcccggtgccggttctctacggcggcagcgtcaatcccggcaattgcgaggaactg
atcggccagcccgatatcgacggcctgttcatcggccgctccgcctggtccgtcgaaggc
tatctcgacattctcgcccgcgtcagcgcggcgatcgaccgctcatctccacgccagacg
gcgagtgaaaggaaactgccatga

DBGET integrated database retrieval system