KEGG   Rhizobium etli CFN 42: RHE_PF00075Help
Entry
RHE_PF00075       CDS       T00317                                 

Gene name
cheBf
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ret  Rhizobium etli CFN 42
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ret02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ret02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:74453..75475
Genome map
AA seq 340 aa AA seqDB search
MSSSATKDIIAIGGSAGSGVVLKTLVADLPADLPASVFVSTHIPANSPGYLPEILSARSK
LPVTQAIDGQLIERGHIYLAAPDRHLLLMGETIKFGAGPRENMVRPSIDPMFRSAALSFG
PRVVGLVLSGMLNDGAAGLHAIKSNGGTTAVQHPLDAEADQMPLAALEAVEVDHVAPAAD
LGKLLAGIAGSDAGPARGPPSAGLRLEVEIAAGARLGSAELRKIASPTALTCPDCHGVLS
EVRGSQPLRFRCQIGHAYTADALVAHIDELDAAIRIAMRVMEERLTLVERMARDARDTGR
TAVAELYEARAVEYKQYSETLRQAALTSLRLGRASRFQDS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccagcgcgaccaaggatatcattgccatcggcgggtcggctgggagcggtgtc
gtcttgaaaaccctggtcgctgatttgcccgccgaccttcccgcaagcgtcttcgtcagc
acccatattcccgcgaattctccgggttatctgccggagatcctatcagcacggtccaag
cttccggtcacgcaggcgattgacgggcaactgatcgagcggggccacatctatctcgct
gcacccgatcgccacctgttgctcatgggcgagacgatcaagttcggtgccggcccgcgg
gaaaacatggtccggccatcgatcgatcccatgtttcgctctgctgccctgtctttcggc
ccgcgcgtggtcgggctcgtgctgagcggaatgctgaacgacggagcggcaggattgcac
gcgatcaaatccaatggggggacgaccgcggtgcagcacccgctcgatgcggaggcagat
cagatgcccttggcagcgcttgaggcagtggaggtcgatcatgtggcgcctgcggctgac
cttggcaagctcctcgccggcatcgcaggcagcgatgcagggccggctcgcggtccgcca
tcggccggtctgcggctggaggtcgaaattgcggctggcgcacgacttggcagtgccgaa
cttcgcaagatcgcctctccgactgccttaacctgtcccgactgtcatggcgtgctttcc
gaggtccggggttcgcagccgctgcgatttcgctgtcagatcggccatgcctataccgcc
gacgcgcttgttgcgcatatcgatgagctcgacgcggcgatcaggattgccatgcgggtg
atggaggagcggctgacgctggtggagcggatggcgcgggacgcgcgcgacaccggccgc
accgcggtcgccgagctctacgaggccagggctgtcgagtacaagcagtattccgagacc
ttgcggcaagctgccctgacgtctctgcgcctcggtcgcgcatcgcgtttccaagatagc
tga

DBGET integrated database retrieval system