KEGG   Rhizobium etli CFN 42: RHE_PF00076Help
Entry
RHE_PF00076       CDS       T00317                                 

Gene name
cheRf
Definition
chemotaxis methyltransferase (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ret  Rhizobium etli CFN 42
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ret00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHE_PF00076 (cheRf)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RHE_PF00076 (cheRf)
Enzymes [BR:ret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     RHE_PF00076 (cheRf)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RHE_PF00076 (cheRf)
Two-component system [BR:ret02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RHE_PF00076 (cheRf)
Bacterial motility proteins [BR:ret02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RHE_PF00076 (cheRf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:75537..79511
Genome map
AA seq 1324 aa AA seqDB search
MMAYDEQESMEQQATAPDPGRYEQPVVIVGIAVCAQSVSSLEQIFSQIDVDLGASYLVAV
RQEGVDATAVLDMLGRQDRLAVTVAVDRERILPNHVYIAGSDDMMTLEDGHIRIRPASEP
IGHRGTIDTMLISLAEHAQERAIAVVLRGLESDGTAGVAATKKFGGLSIVEAGEGTDGST
EEGGGALAIADLRLPAQGIATHIALYAGNVTEEEDAGLDDERPSVLEAQITQIATILRNV
TSHDFHGYKRGTFTRRVQRRMQVLQIASIEAYIERLRASRDEVQNLFQDLLIGVTQFFRD
PAEFEALEREIPRLFEGKEPGDQLRVWVLGCATGEEAYSIAMLLREHMATMDYPPDVQIF
ATDLDARALGIARGGRYSAAITSQVPPERLARWFVREGDTYCVVKELREMCIFSPHNIVK
DAPFSRIDILSCRNLLIYLDSELQNRVIPIFHFALRPSGILFLGSSENVTRHAKLFAPVD
RKNRLFRRLETATRIIPDFPLSPRPRSPDHPLSAPAPMLQTGRLSATISRQAEVVAERFA
PAYVVVDSHYDVLHFSGRTGRYLEPASGTATLNLLSLAHRDLRLDMRSALQRATTEAVKV
EVPRVLLRQDDRTYAVNIIVEPLGSGDVTSLIVLFQDAGQVAEGTAPDGGRLTSEEHVQR
LETDLRVTRDRLQATIEELESTNEELKSSNEEYQSINEELQSANEEMETSKEELQSVNEE
LQTVNGELAHRVTELDRTNSDLKNLLEATQIATVFLDNDLRVRSFTPAATEIFHLLDTDV
GRPLDHVVSRVAYPELLDDVRLVLRTLVPTDRKVSDPTNNRHYAARALPYRSVDNYISGA
VVTFTDLTATYEAEVALRRSEERLQRVLETDAVGVIFLNRDGVIFDANEVFLKMSGYTRS
QMERGELHWRRLTPEEHHAESEAQMEALKETGKIGPYEKEYFLADGTRRWMLFAGRDLGD
GTVAEFCIDISARKQAQAALRQGEEQFRLFGEASSDVLWIRDAETLQWVYLTPAFETIYG
VDREQAMTGNNFRSWAELIIPEDREQALSEIGRVREGERVEFEYRIRRASDHEIRWLRNA
DFPLFGEEGNVKQIGGIGRDITEEKASAERMKVLVAELQHRTRNLMAVVRSMAEKTMRTS
TDLADFHERFRDRLDVLARVQGLLSRLQEGDRITFDQLIRSELAAHGMLEGENSRISLQG
PDGVRLRSTTVQTMALAMHELGTNAVKYGALSQARAHLAITWRVEQSGEGGKPWLHVDWQ
ESGVKMPAADSGLQGGGQGRELIERALPYQLDAKTSYVLGEDGVHCTIAIPVSLSNLIEA
EAYG
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgtacgacgaacaggaaagcatggagcagcaggcaaccgcgcctgacccgggc
cgctacgagcagccggtcgtgatcgtcggcatagcggtgtgtgcgcagtccgttagttca
ctcgaacagatattctcgcagatcgacgtagatctcggcgcatcctaccttgtggcggtg
cgccaggagggggtcgatgccacggccgttcttgatatgctggggcggcaggatcgcctt
gcggtgacagtcgcagtcgatcgagagcggatccttccaaatcacgtctacatcgccggc
tccgacgatatgatgaccctcgaagacggtcacatccgcattcggccggcatcggagccg
atcggccatcggggcacgatcgacacgatgttgatctcactcgcagagcatgcccaggag
cgcgccattgccgtagtcctcagggggctcgagagtgacggaacagccggtgtggcagcg
acaaagaaatttggcggcctgtcgattgtggaggccggcgaaggcaccgatggatccacc
gaggaagggggaggggcgttggcaattgccgacctgcgcctgccggcacaggggatcgca
acgcatatcgcactgtacgccggcaatgtgaccgaggaagaagacgctggtctggatgac
gagcggccaagcgtgctcgaggcgcagatcacgcagattgcaacgattcttcgcaacgtc
accagccatgacttccatggatacaagcgcggcacgttcacgcggcgcgttcagcgacgc
atgcaggtgctgcagatcgccagcatcgaggcctatatcgagcggcttcgtgccagccgc
gacgaggtccagaatctttttcaggaccttttgatcggcgtgacgcagttcttcagggat
ccggccgagttcgaagcgcttgagcgcgagattccaaggctgttcgaaggcaaggagccg
ggagaccagttgcgcgtctgggtgctcggttgcgccacgggcgaggaagcctattcgatc
gccatgctgttgcgcgagcatatggccaccatggattacccccctgatgtgcagatattc
gcgacggatcttgacgcgcgcgcgctggggattgcccgcggcggccgctattccgctgca
ataacctcacaggtaccgcccgaacggctggcccgctggttcgtgcgtgagggcgacacc
tattgcgtcgtcaaggaattgcgggagatgtgcatcttctcgccgcacaatatcgtcaag
gatgcgccgttctcgcgcatcgacatcctgtcttgccggaacctgctgatctatctcgac
agtgagctgcaaaaccgggtgatcccgatcttccactttgccttgaggccaagcggtatc
ctgtttttgggttcttcggaaaacgtcacccgccacgccaagctttttgcgcccgtcgac
cgcaaaaaccggctgtttcgaaggctggaaacggcaacccgcatcattcccgatttcccg
ctcagtccacgcccgcgcagccccgatcatccgctttcagcaccggctccgatgctgcag
accggccggctgtcggccacgatcagccggcaggcggaggtcgtcgccgagcgcttcgcc
cccgcctatgtggtcgtcgattcgcattatgacgtgctgcacttctccggacgcacaggc
cgctatctcgaacccgcgtcggggacggcgacgctcaatcttctgagccttgcccatcgc
gacctccgactcgacatgcgttcggccctgcagcgtgcgacgaccgaagccgtcaaggtc
gaggtgccgagggtactgctgcgccaggatgaccgcacctacgccgtcaacatcatcgtc
gaaccgctcggcagcggcgacgtcacctcgctgatcgtgctgttccaagacgcggggcag
gtggccgagggcactgcgcccgatggcggaaggctgacaagcgaagagcatgtccaacgt
ctcgagactgatcttcgggtgacgcgcgaccggctgcaggcgacgatcgaggagctggaa
tcgacaaacgaggagctcaaatcctcgaacgaagaatatcagtcgatcaacgaagaactg
cagtcggccaatgaggagatggaaacctcgaaggaagagctgcagtccgtcaacgaggaa
ctgcagactgttaacggcgagcttgcccaccgtgttaccgaacttgaccggaccaattcc
gacttgaagaacctcctggaggcgacgcagatcgccaccgttttcctcgacaatgatctg
cgcgtcagaagcttcacgcctgcggcgaccgaaatattccatctgctcgacacggatgtc
ggccggccgctcgaccatgtcgtctcgcgcgttgcctatccggaactgctggatgatgtt
cgcctcgtactcagaacgcttgtgccgactgaccgaaaggtcagcgatcccaccaacaac
cggcattacgccgcacgcgccctgccttaccgcagcgtcgacaattatatcagcggtgct
gtcgtcaccttcaccgacctgaccgctacctacgaggcggaggtcgcgcttcgacgcagt
gaagagcgcctccagcgagtcctggagacggatgcggtcggcgtaatttttctcaatcgg
gatggtgtcatattcgacgccaacgaagtcttcctgaagatgtcgggatacacccgctcg
caaatggagcgcggcgagctgcactggcgccggctgaccccggaggagcaccacgccgag
agcgaggcacagatggaagctctgaaagaaaccgggaaaatcggcccctatgagaaagag
tattttctcgccgacgggacgcgtcgctggatgttgtttgccggccgcgatcttggcgac
ggcacggtcgccgagttctgcatcgatatctcggcacgaaaacaggcccaggcagctctg
cggcagggggaggagcagttccgcctcttcggcgaagcctcctccgacgtattgtggatc
cgcgacgcggagacgctgcaatgggtttatctgacgccggccttcgagaccatctatggt
gtcgaccgcgagcaggcgatgaccggcaacaatttccgcagctgggcggaactgatcatt
cccgaagatcgagaacaggcgctctcggagatcggccgggtgcgggagggcgagcgcgtc
gaattcgagtaccgcatcagacgcgcctctgaccacgagatccgctggctgcggaatgcc
gatttcccgcttttcggcgaggaaggaaacgtcaagcagatcggcggtatcggccgcgat
atcaccgaggaaaaagcctccgccgagcggatgaaggttctcgtcgccgagcttcagcac
cgcacgcgcaacctgatggccgtcgtccggtctatggccgagaagaccatgcgcaccagc
accgatctggccgacttccacgaaaggttccgggaccgtctggacgtgctggctcgagta
cagggtcttttgtcgcggctgcaggaaggcgatcgcatcaccttcgaccagctcatccgc
tcggaactggccgcacatggcatgctggaaggcgaaaacagccggataagcctgcaaggt
cctgatggcgtcaggcttcgttccaccaccgtgcagaccatggcattggccatgcacgaa
ctcggcaccaacgcagtcaaatatggagcgctcagccaggcccgagcgcatctggccatc
acctggcgcgtcgagcaatccggcgaaggcggcaagccatggctgcatgtcgactggcag
gaaagcggggtgaagatgccagccgcggattccgggctgcaagggggtggtcagggtcgc
gaactgatagagcgagcgctcccttatcagcttgatgcgaagacctcctacgttctcggt
gaggacggggttcattgcacgatcgcaattccggtttctctcagtaatctgatcgaggcc
gaagcctatggctga

DBGET integrated database retrieval system