KEGG   Rhizobium etli CFN 42: RHE_PF00262Help
Entry
RHE_PF00262       CDS       T00317                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ret  Rhizobium etli CFN 42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHE_PF00262 (malQ)
Enzymes [BR:ret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RHE_PF00262 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:complement(278847..280760)
Genome map
AA seq 637 aa AA seqDB search
MKSAELDKLARRYGISPTRPSPEDREVTISADTKRKILSALEVELSADRETRGPRRGQES
ERADQTIPQSFLPDFLLKTRVWGISLQLYELRSARNWGIGDFEDLSDAADLAGKLGADFI
GLNPLHAPFLADPDRCSPYEPSSRQHLNPLYIAVDRLPGFVGSAQLERQLEGLRRSNLVD
YAGVARAKLGTLRDLWRAWLQAGAADETYDRVDFDAFVARGGNSLRRHALFECLSLFMVE
HGAGAGWQAWPADFRRFDSAAVAEFAREHEDEVRFHMWLQWLAHGQLLQAADRAREAGLR
IGLYLDLAVGEAVDGSATWSEPDVYISKATIGSPPDPFAVEGQDWHLAGYLPSAIAAGDS
SPYRRMVSAAMRYAGAIRIDHAPALRRLFLVPLGSRPDGGAYVRYPQHRLLQILAETSAE
YRCLVIGEALGMIPPDLPDELAAAQILSYRILSYEQDGKGFKPPDAYPVFGLTCISTHDH
QTLAGWWRSADIQDRREHGIVPPDLTAKHLQQRRRERRSLKAALRAAGIDVPTRLGARAS
RETLRDLTVSAYRFIARTPSLLVAVRLADLTDEKRPTNIPGTSDSYPNWKPKLSVSLEGL
ASNPLLDRITAAMREERPRIHAAGERSGSRRISKRQG
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgccgagctcgacaagctcgcccggcgatacgggatcagtccgaccaggccc
agtcccgaggatcgtgaggtgacgatttccgccgacaccaaacgcaagatactctcggct
ttggaagttgaactttcggcagatcgcgagacgaggggaccgcgacgggggcaggagtcg
gagcgggcggatcagacgatccctcagtcatttctgccggacttcctgctcaagacgcgg
gtctgggggatcagcttgcagctttacgaactgcgttcggcgcgaaactggggcatcgga
gattttgaggatttgtccgatgcggccgacctggcggggaagcttggggctgatttcatc
ggcctcaatccgcttcacgcaccatttcttgccgatcccgatcgctgcagcccctatgaa
ccttcaagccgtcagcatctcaacccgctctatatcgcggtcgaccgattgccaggtttt
gtcggtagtgcccaactcgaacggcaattggagggacttcgccgaagcaacctcgtcgat
tatgccggagttgcgagggccaagcttggaactctgcgggatctctggcgcgcctggctg
caggcgggcgccgccgatgaaacctacgatcgcgtcgatttcgatgccttcgtcgcgcga
ggcggcaacagcttgcggcgccatgcgctctttgaatgtctttcgcttttcatggtggag
catggggcaggcgccggctggcaggcatggccggcagatttccggcgcttcgacagcgct
gccgtcgccgaattcgcgcgtgagcatgaggacgaggtccgttttcatatgtggctgcag
tggctcgcccacgggcagttgctgcaggcggcggaccgggcgcgcgaagccggcctgcgg
atcgggctttatctcgatcttgccgtgggcgaggcggtcgacggatcggcgacatggagc
gagccggatgtctatatctcgaaggcgaccatcggcagtcctcccgatccgttcgcggta
gaggggcaggactggcatctcgccggatatctgccgtcggcgatcgctgcgggagacagt
tctccttaccggcgcatggtgagcgccgccatgcgatatgccggtgcgatccgtatcgat
cacgccccggcgctccggcgcctctttctggtgcctctcggcagcaggccggatggcggc
gcctatgtccgctacccccagcatcggcttctgcagatcctggccgagacgtccgccgag
tatcgatgcctcgtcatcggtgaagcgttgggaatgatcccgcccgatttgcctgacgag
ctcgcggcggcgcagatcctttcgtatcgcattctctcctatgaacaagacgggaaaggc
ttcaagccgccggatgcctatcccgttttcggcctgacctgcatttcgacgcacgaccat
cagacgcttgccggctggtggcgcagcgccgacatccaggatcgtcgcgagcacggaatc
gtgccgcccgatctcacggcaaaacatctccagcagcgccggcgcgagcgacgaagtctg
aaggcggcgctccgcgctgccggcatcgatgtgccgactcgtctcggtgcaagagcaagt
cgggagaccttgagggacttgactgtcagcgcctaccgcttcatcgcccgtactccatcg
cttctcgtcgcggttaggcttgccgacctgactgacgagaaaaggcccaccaacatccct
ggcacgagcgatagctaccccaactggaagccgaagctgtcggtgtcgctggagggcctg
gcgtcgaacccactgctggatcgcattacggcggcgatgcgggaggaaaggccacggatt
cacgcggcaggggaacgatcagggagcaggcggatttcgaagagacagggataa

DBGET integrated database retrieval system