KEGG   Rhizobium etli CFN 42: RHE_PF00263Help
Entry
RHE_PF00263       CDS       T00317                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ret  Rhizobium etli CFN 42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHE_PF00263
Enzymes [BR:ret01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RHE_PF00263
Exosome [BR:ret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHE_PF00263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:complement(280757..282550)
Genome map
AA seq 597 aa AA seqDB search
MTKMIFGPAFTEDGVLFRLWAPLHESVSLKIEGTDPRPMQAAEDGWHQCTVADAGPGTQY
RFILPDGLQIPDPASRFQPQDVHGASEVVDLAAYRWNTREWTGRPWEEMVIYELHIGCFT
PQGTFKAAIDRLDHLRELGVTALQIMPLSDFPGRYNWGYDGVLPYAPDSTYGRPEDLMAL
VDAAHERSISVFLDAVYNHFGPDGNYIPSYAPLFTDHHRTPWGHGINYDGDGSEMIREFF
IENATYWINEFRLDGFRFDAVHAIKDDSAEHLLHALARRVRAAAGDRHVHLIVENEANDS
DLLKRDADGEARLFTAQWNDDVHHVLHITATGETFGYYADYAGDAGKLGRALTEGFVFQG
EHMPYRGRSRGRPSGHLPPTAFVSFIQNHDQIGNRALGDRIMASSPTDAVKAVTSIYLLA
PQIPMLFMGEEWGAREPFPFFCDFDESLNEKVRKGRREELSRLPGFDSDELLDPTAPSTF
AAAKLDWSKRTSSEMLEFYRMLLDLRHQRIVPLLKGAGGGNAVSRSAGSTLVVDWALAGD
RRLHLDANLGSEAAPLLQQRNEGEMIFRLGGSDGGKLAPWTVIWSISKGEGMKAIGR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaaaatgatattcggccccgcattcaccgaagatggcgttctgtttcgcctttgg
gctcctctgcatgaaagcgtttcattgaaaatcgaaggcactgatccgcgcccgatgcaa
gcggctgaagacggctggcatcaatgcacggtcgcggacgcgggtcccggtacgcagtat
cgcttcatcctgccggacggtcttcaaattcccgatcctgcctcgcgcttccagccgcag
gatgtgcatggtgcaagtgaagtggtcgaccttgctgcctatcgctggaacacgcgcgaa
tggaccggccggccctgggaggagatggtcatttacgaactgcatatcggctgcttcaca
ccgcaggggactttcaaggccgcgatcgatcgtctcgatcatctgcgggaactgggcgtc
acggcgctgcagatcatgccgctcagcgacttccccggccgctataactggggctatgac
ggcgtgcttccctatgcacccgacagcacttacggccggccggaagatcttatggcgctg
gtggatgcggcgcacgagcgtagcatctcggttttcctcgacgcggtctacaaccacttc
ggacccgacgggaactatattccctcctacgcgccgctctttaccgatcatcacaggacg
ccctggggccacggcatcaattatgacggcgacggctctgagatgatccgcgaattcttc
atcgagaacgccacctattggatcaacgagttcaggctcgacggttttcgcttcgacgcc
gtccacgccatcaaggacgatagcgctgagcatcttcttcacgcgctggcccgccgcgtc
agggctgcggccggtgaccggcatgttcatctgatcgtggaaaatgaggcgaatgacagc
gaccttctgaaacgtgacgcagacggcgaggcaaggctgttcacggcccaatggaacgac
gatgtccaccatgtgcttcatattaccgccacgggtgaaaccttcggttactatgccgac
tatgcaggtgacgccggcaagctcggcagggcgctgacggaaggcttcgtgttccagggc
gagcacatgccgtatcgcggccgaagccgaggtcggccgagcggccatctgccgcccacc
gccttcgtgtcctttatccagaatcatgaccagatcggcaaccgggcgctgggggaccgg
attatggcttcgagcccgaccgacgccgtcaaggctgtcacatcaatctacctgctggca
ccgcagataccgatgctgttcatgggtgaggaatggggtgcgcgagagccttttccgttt
ttctgcgatttcgacgagagcctgaacgagaaggtcaggaagggcaggcgcgaggagctt
tcgcgcctgccgggtttcgactctgacgagcttctagatccgacggcgccgtcgaccttt
gcggccgccaagctcgactggtcgaaacgtacctcgtcggaaatgcttgaattctacaga
atgcttctcgacctccggcatcaaaggatcgtgcccctgctgaagggcgccggcggcgga
aatgcggtctctcgctccgcgggttcgacgcttgtggtggattgggccctggccggcgac
cggcgccttcatctggatgccaatctcggcagcgaggcggcgccgcttctccagcagcgc
aacgaaggggagatgatcttccgcctcggcggcagcgatggaggcaaactggcgccctgg
acggtgatctggagcatttcgaaaggtgagggcatgaaggcgatcggacgatga

DBGET integrated database retrieval system