KEGG   Rhizobium etli CFN 42: RHE_PF00365Help
Entry
RHE_PF00365       CDS       T00317                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ret  Rhizobium etli CFN 42
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RHE_PF00365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHE_PF00365
  Lipid metabolism
   00071 Fatty acid degradation
    RHE_PF00365
  Amino acid metabolism
   00350 Tyrosine metabolism
    RHE_PF00365
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RHE_PF00365
   00626 Naphthalene degradation
    RHE_PF00365
Enzymes [BR:ret01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RHE_PF00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:complement(413191..414420)
Genome map
AA seq 409 aa AA seqDB search
MSLFAALRLPREILFGIGQRHALASVASRTGRRALVCTDARFASTPAFAEMISAIEAAGI
SVLVHDQTLPDVPRDTVAACVEAARGFKPDMVIGIGGGSCLDMAKCASLLLSHGGALSDY
YGEFKVPAPVLPIIAVPTTAGTGSEVTPVAVVSDPDRTLKVGISSPYLIAAAAICDPDLT
VSCPPGLTAVAGADALTHAIEAFTAMRRPGDPELAQQHVFVGKSDLSDQFALYAIRLLSR
SLEKAFTDGSDIEARCDVMMGALAAGCAFGTAGTAAAHAVQYPVGALTHTPHGLGVATML
PYVMTFNRRVAAAEIAAVGRALGLDPNGVENDTAVADSAITEVSRLFATIGIAPTLARLG
LPEDRIDWAAEQALGIGRLIKNNPRQLDSAAMRGLLRAAYDGDLAASAL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtttgccgccttgaggctgccgcgggagatcctgttcggtatcggccagcgc
catgcgctcgcgagcgtcgccagcaggaccggccggcgcgcgctcgtctgcacggacgcg
cgttttgcctcaacgcccgccttcgctgaaatgatctccgccatcgaagccgccggcatc
tccgtactggtccatgatcagacgctgccggacgtgccgcgcgacacggtcgccgcttgc
gttgaggccgcgcgtggctttaagcccgatatggtgatcggcatcggcggtggcagctgc
ctcgacatggcgaaatgcgcgtcgctgttgctctctcatggcggcgcgctttccgattac
tatggtgagttcaaggtgccggcaccggtcctgccgatcattgctgtgccgaccacggca
ggcacaggctccgaggtgacgccggtggcggttgtatccgatccagaccgcaccctgaag
gttggcatttcgagcccctatctcatcgccgccgcggcgatatgtgatccggatctcacc
gtatcctgcccgcctgggctcacggcggttgccggtgcggatgccctgacgcatgccatc
gaagccttcacggcgatgcgtcgccccggcgacccggaacttgcgcagcagcatgtgttt
gtcggcaagagcgacctgtccgaccagttcgcactatatgctatccggctcctcagccgg
agccttgaaaaggccttcaccgacggttcggacatcgaagcgcgctgcgatgtgatgatg
ggtgcgctcgcggcgggctgtgccttcggaaccgcaggcaccgctgccgcccatgcggtg
caataccctgtcggtgctctgacccatacgccgcacgggctcggggtggctacgatgctg
ccctatgtaatgacattcaaccgccgcgtcgctgcagcggagattgccgctgtcggtagg
gcgctcggcctcgaccccaatggcgttgagaacgacacggcggttgccgattccgcaata
accgaggtgagccgcctctttgccacgatcgggattgcgccgacgctcgccagactcggc
ctacctgaagaccggatcgactgggcggccgagcaggcactcggcatcggccggctgatc
aaaaataatccacggcagctcgattcagccgccatgcggggcctgttgcgggcagcctat
gacggcgaccttgccgcttccgccctctga

DBGET integrated database retrieval system