KEGG   Rhizobium etli CFN 42: RHE_PF00442Help
Entry
RHE_PF00442       CDS       T00317                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ret  Rhizobium etli CFN 42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ret00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RHE_PF00442
Enzymes [BR:ret01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     RHE_PF00442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UNAM_f: 
RhizoBase: 
UniProt: 
Position
p42f:494177..495604
Genome map
AA seq 475 aa AA seqDB search
MTVALWSQSMTGANPAHIGANAPTVKPRPAFAQTDLVALSRYFSLLMMRNITSDGYVIED
PTSPGVFSAPGCVIAAPSYPANTPGVDQDYVFNWVRDGAITAIEIALAGLLPIPGGVLPS
LVDYVNFAALCQANAKNSDTVTLGHACFTITGEVRPWSEQNDGPAIQSIAILTLFDQLDG
ATQTIAKQLVQANLAYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISTNTIGIAVP
AGVAGAISWLESQLATHWNGQLYVSILDALEQAGYDANIDIVSSVCYGGIEPTDTKLLAT
AAILRRQWADPSSSNYYPVNGADAAKGLGPLFGRYPGDHYDGDVAAPVAGGHPWALCTAN
FAEFQYRLANAIDASGAIPLDQFSEPFFAEMGLGASSSAADASAALRASSDAMLRAIVYH
SDYYELSEQFDGTVGYEKSVRNLTWSYASFLSAVRARAAAPATKSKPRNSRGPKS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgctttggagtcagtcaatgacgggtgcgaacccggcccatatcggcgcc
aatgcgcctacagtcaaaccgaggcctgccttcgcgcagacggatctggtcgcattgtcg
cgctatttttctcttctgatgatgcgcaacatcaccagcgatggctatgtcatcgaggat
cccacatcgcccggcgtcttttcggccccgggctgcgtcatcgccgcaccctcctatcca
gcgaacacgccgggtgtcgaccaggactatgttttcaactgggtccgcgacggggccatt
acggccatcgagatcgcgcttgccggcttgttacccattccgggcggagttttgccgagc
ctggtcgactacgtgaacttcgccgcgctctgccaggcgaatgcgaagaattccgacacc
gtcacacttggccacgcctgcttcaccatcaccggcgaggttcgtccgtggtcggagcag
aatgacgggccggccattcagtcgattgcgatcctcaccctgttcgatcagctggatggc
gccacgcagacgatcgccaaacaactggtccaggccaacctcgcttatcttctcgaagtt
taccagaacaagaccacaaatctctgggaggaatatgagggctattcgtttttcgcaaga
gccgtacagctccgctttttccgggaaatttccacaaacacgatcggcattgcggtgcct
gccggggtggccggcgccatctcctggctggaaagccagctggcaacccactggaacggg
cagctctatgtgagcattctggatgccctggagcaagccggttacgacgcgaacatcgat
atcgtctcttcggtctgctatggcgggatcgagccaaccgataccaagcttctggcaacg
gcggccatcttgcggcgccagtgggccgatccttcgtcttcgaactattacccggtcaat
ggcgccgacgcggccaaagggctcggaccactcttcgggcgctatccaggcgaccattac
gatggcgatgtggcggctccggttgccggcgggcatccctgggctctgtgcaccgccaat
ttcgccgagtttcaatatcggcttgccaatgccatcgatgccagcggcgccatccccctc
gatcagttctccgaacccttcttcgcggaaatgggacttggcgcatcgagcagcgccgcc
gacgcgtcggctgctttgcgggcttcgtctgacgccatgctgcgcgccatcgtctaccac
agcgattactatgaactgagcgaacagttcgatggaaccgttggctacgagaaaagcgtc
cggaatctgacctggagctatgcctccttcctctcggcagtcagagcccgcgccgccgcc
ccggccaccaagtccaagccccgaaactctcgcggcccgaaatcatga

DBGET integrated database retrieval system