KEGG   Ralstonia eutropha JMP134: Reut_A0304Help
Entry
Reut_A0304        CDS       T00268                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00260  Glycine, serine and threonine metabolism
reu00680  Methane metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00002  Glycolysis, core module involving three-carbon compounds
reu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_A0304
  Energy metabolism
   00680 Methane metabolism
    Reut_A0304
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Reut_A0304
Enzymes [BR:reu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Reut_A0304
Membrane trafficking [BR:reu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Reut_A0304
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Reut_A0304
  Exosomal proteins of melanoma cells
   Reut_A0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AAZ59686
UniProt: Q476J7
Position
1:complement(336930..337676)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTDTGAAQARLAGKLLKEAGFAFDVAYTSVLKR
AIRTLWHVQDEMDEMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDPRASYDDPRYANVPREQIPLTECLKDTVARVLPLWNESIAPDIQSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDASLRPLRHYYLGDQEAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctagtcctcatccgccacggcgaatcgacgtggaacctcgaaaaccgcttc
accggctgggtcgacgtcgacctgactgacaccggcgccgcgcaagcccgcctggccggc
aagctgctcaaggaagccggcttcgccttcgacgtggcctacacgtccgtgctcaagcgc
gcgatccgtacgctgtggcacgtgcaggacgaaatggacgagatgtggatcccggtacgc
aacgaatggcgcctgaacgagcgccactacggtgcgctggccggcctgaacaaggcagaa
accgccgccaagttcggcgacgagcaggtgctcgtgtggcgccgcagctacgacacgccg
ccgcccgcgctggagccgaccgatccgcgtgcctcttacgacgatccgcgctacgccaat
gtgccgcgcgagcagattccgctgaccgaatgcctgaaggacaccgtggcccgcgtgctg
ccgctgtggaacgaatccatcgctccggacatccaatcgggcaagcgcgtggtcattgcc
gctcacggcaacagcatccgcgccctggttaagtacctggatcagatttcggatgacgat
atcgtcggcctcaacatccccaatggcaccccgctcgtctacgagctggacgccagcctg
cgcccgctgcgccactattacctgggcgaccaggaagccatcgccgcctcgctggcggcc
gtggccagccagggcaaggcccgctga

DBGET integrated database retrieval system