KEGG   Ralstonia eutropha JMP134: Reut_A0607Help
Entry
Reut_A0607        CDS       T00268                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu02020  Two-component system
reu02030  Bacterial chemotaxis
Module
reu_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:reu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Reut_A0607
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Reut_A0607
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Reut_A0607
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Reut_A0607
Two-component system [BR:reu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Reut_A0607
Bacterial motility proteins [BR:reu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Reut_A0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Zn-ribbon_8 Zn_ribbon_recom Anti-TRAP TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AAZ59989
UniProt: Q475E4
Position
1:complement(655122..656108)
Genome map
AA seq 328 aa AA seqDB search
MTRNVVTIGGSRGAFTVLRDVVAALPAALDAAVFIVLHVGKHKSELPSLLTRWGKLPASY
PQHGDVWKPGHIYVAPPDHHMLITADTIHLSHAAKENFSRPAIDPLLRSAAVALGSRVIG
VILSGDLDDGAAGLAFVRAFGGRTLIQNPRDAEATSMPKSAMEAAGADLMASPAELGHAI
VALLQASGEGEFDPKREKDMQALRSEAATADNPAGSAFEELDSIAARAAITCPECGGAMW
QLRDTHPLRFRCHTGHAFSGMTLTAAEDKATEHAMWTAVRAQKEALALARIRAAHAKSDG
NRDAYQIELSRIQQCERLLKVLQGAIAE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggaatgtcgtcacaatcggcggttcacgcggcgcgttcaccgtgttgcgggac
gtagtggctgcattgcctgcagcgctcgacgccgcggttttcatcgtgctgcacgtaggc
aagcacaagtcggagctgccatcgttgctcacgcgatggggcaagctaccggcctcgtat
ccgcagcacggagacgtctggaaaccggggcacatctatgtggcgccgcccgatcaccac
atgctgattacggcggacaccatccacctttcgcatgcggccaaggagaacttcagccgg
ccggcgatcgatccgctgctccggtccgccgccgttgcgctcggatcgcgggtgatcggc
gtgattctcagcggcgatctcgatgacggtgccgccggactggccttcgtacgcgccttt
ggcgggcgcacgctgatccagaacccgcgcgacgcggaggcaacgtcgatgccgaagtct
gccatggaagctgcgggcgccgaccttatggcgagcccggcagaactcggccatgccatt
gtcgcgctgcttcaggcaagcggcgaaggcgaattcgatccaaagcgggagaaagacatg
caagcactgcgaagcgaagccgccaccgcggacaaccctgcaggcagcgccttcgaggaa
ctggacagcatcgccgcacgcgcggccattacgtgcccggaatgtggcggagcgatgtgg
caactgcgcgatacgcatccactgcgcttccgctgccataccggccacgcgttcagcggc
atgaccctcacggcggccgaggacaaggccaccgagcacgcgatgtggaccgcggtgcga
gcgcagaaggaagcgcttgcgctggcacgcatccgcgccgcgcacgcgaagtccgatgga
aaccgggacgcgtatcagatcgagctgtcgcgcatccagcagtgcgagcgcctgctaaag
gtgctgcagggcgctatcgccgagtga

DBGET integrated database retrieval system