KEGG   Ralstonia eutropha JMP134: Reut_A0645Help
Entry
Reut_A0645        CDS       T00268                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
reu  Ralstonia eutropha JMP134
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Reut_A0645
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Reut_A0645
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Reut_A0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:693438..694880
Genome map
AA seq 480 aa AA seqDB search
MSSLDSGDQKISAPLGVSEPSGPNLLSRIGRWWGRKGDAEAAPVPAKNADPALLPARVAR
RQREQLRLCLDARLTDSNANAAAQAWQAEYESADEAVRSGMLEVLAEVAGSTGPEEGAAD
ADKPGKSARAGSGLTQALSNARIRFFKRLAALHGQRGNSACGLHFLIHLRADMLRWQRRI
PGLRVLDEDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEISSWTDLRNRLD
SDRRCYAFFHPRIPREPLIFVEVAFVPDMAANVQTLLDEAAPLEDLRRVKWAIFYSISNT
QAGLRGVSFGNFLLKRVIEELQREFPKVRQFATLSPIPGFADWLRKLDAAGVAGALGEKR
IARWKERHGEVPADGAAWLEALPADSHDAIVRDTALALAAHYLVRERSHAMPADPVARFH
LGNGACVERLNWGADMSRKGRTQSCGMMVNYLYAPEALDDNLARLGEGNPRISRAVGKLL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctcgactccggcgaccagaagatcagcgccccgctgggcgtgagtgaacca
tccggccccaacctgttgtcccggatcggccgctggtggggccgcaagggcgatgcggaa
gccgcgccagtcccggcgaagaacgccgacccggcgctgttgcccgcgcgcgtggcgcga
cgccagcgcgaacagttgcggttgtgcctcgacgcgcggctgaccgacagcaatgccaac
gcggcggcgcaggcgtggcaggcggagtacgagtcggcggacgaagccgtgcgcagcggg
atgctggaggtgctggcggaagtggccggcagcacgggtccggaagagggcgcggcggac
gccgataaaccgggcaagtccgcacgcgccggttccggtctgacgcaagccttgtcgaat
gcgcgcatccgcttcttcaagcggctggccgcgttgcacggccagcgcggcaacagtgcg
tgcgggctgcatttcctgatccatctgcgtgcggacatgctgcgctggcagcggcgtatt
ccgggcctgcgcgtgctggacgaggacctcgaagcgctgttctccaactggttcgatgtc
ggcctgctggagttgcagcccatcacgtgggactcgccggcgtcgctgctcgagaagctc
atccgctatgaagccgtgcatgagatttcatcgtggacggacctgcgcaaccggctcgat
tccgaccggcgctgctacgcgttcttccatccgcgcatcccgcgcgagccgctgatcttc
gtcgaggttgcgttcgtgcccgacatggccgccaacgtgcagacgctgctcgacgaggct
gcgccgctggaagacctgcgccgcgtgaaatgggccatcttctattcgatctcgaacaca
caggcgggactgcgcggggtgagcttcggcaactttctgctcaagcgcgtgatcgaggaa
ctgcagcgcgagtttccaaaggtcaggcagttcgcgacgctgtcgccgattccggggttt
gccgactggctgcgcaagctcgacgccgcaggcgtggccggcgcgcttggcgagaagcgc
attgcacggtggaaagaacggcacggcgaagtgccggccgatggcgcggcgtggctggaa
gcgttgcccgcagattcccacgacgccatcgtgcgtgacacggcgctcgcgcttgccgct
cactacctggtgcgcgaacgcagccacgccatgcccgccgaccccgtggctcgcttccac
ctgggaaatggcgcctgcgtggaacggctgaactggggtgcagacatgtcgcgaaaaggc
cgcacacaatcgtgcggcatgatggtgaattacctttacgcgcccgaggcgctggatgac
aatctagcgcgccttggcgaaggcaacccgcgcatcagtcgtgcagtggggaagctgttg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system