KEGG   Ralstonia eutropha JMP134: Reut_A0708Help
Entry
Reut_A0708        CDS       T00268                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:reu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:reu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:767455..768426
Genome map
AA seq 323 aa AA seqDB search
MTKTFRNPQLTKNGELKHLLSIEGLSRDMITHILDTASQFVSLSDSDRDVKKVPLLRGKS
VFNLFFENSTRTRTTFEIAAKRLSADVLNLNINASSTSKGESLLDTINNLSAMSADMFVV
RHASSGAPYLIAEHVAPHVHVINAGDGRHAHPTQGLLDMYTIRHFKKDFTQLRVAIVGDI
LHSRVARSDIHALTTLGVPEVRAIGPRTLLPSGLEQMGVRVFHNMEEGLKDVDVVIMLRL
QNERMSGALLPSAQEYFKAFGLTPERLALAAPDAIVMHPGPMNRGVEIDSAVADGPQSVI
LNQVTFGIAVRMAVMGIVAGNSD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacgttccgcaacccgcagctgaccaagaacggcgaactgaagcacctgctg
tcgatcgagggattgtcgcgtgacatgatcacgcacatcctcgataccgccagccagttc
gtgtcgctgtccgactctgaccgcgatgtgaagaaggtgccgctgctgcgcggcaagagc
gtgttcaacctgttcttcgagaactctacgcgtacgcgcaccaccttcgagatcgccgcc
aagcggttgtcggcggacgtgctgaacctgaatatcaacgcctcgtcgaccagcaagggc
gagtcgctgctggacacgatcaacaacctgtcggccatgtcggcggacatgttcgtggtg
cgccacgccagttcgggcgcgccgtacctgatcgccgaacacgttgcaccgcacgtacac
gtgatcaacgccggcgacggtcgtcatgcgcacccgacgcaaggcctgctggacatgtac
acgatccggcacttcaagaaggacttcacgcaactgcgcgtggcgatcgttggcgacatc
ctgcactcgcgcgtggcgcgttcggatatccacgcgctgaccacgctcggcgtgccggaa
gtgcgcgccatcggcccgcgtacgcttctgccgtcgggactcgagcagatgggcgtgcgt
gtcttccacaacatggaagagggcctgaaggacgtggatgtggtgatcatgctgcgcttg
cagaacgaacgcatgagcggcgcgctactgccgtcggcgcaggagtacttcaaggccttc
ggcctgacgccggaacgcctcgcgctggccgcacccgacgcgatcgtgatgcacccgggg
ccgatgaaccgtggcgtggagattgactccgcggtggcggacggcccgcaatcggtgatc
ctgaaccaggtgacgttcggcatcgccgtgcgcatggccgtgatgggtatcgtggcagga
aacagtgactga

DBGET integrated database retrieval system