KEGG   Ralstonia eutropha JMP134: Reut_A0745Help
Entry
Reut_A0745        CDS       T00268                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_A0745
   00030 Pentose phosphate pathway
    Reut_A0745
   00051 Fructose and mannose metabolism
    Reut_A0745
   00052 Galactose metabolism
    Reut_A0745
   00500 Starch and sucrose metabolism
    Reut_A0745
   00520 Amino sugar and nucleotide sugar metabolism
    Reut_A0745
  Nucleotide metabolism
   00230 Purine metabolism
    Reut_A0745
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Reut_A0745
Enzymes [BR:reu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Reut_A0745
    5.4.2.8  phosphomannomutase
     Reut_A0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:805773..807158
Genome map
AA seq 461 aa AA seqDB search
MQIDPSIFKAYDIRGIVGKTLTRDVARLIGLSFGSAAAEAGEKAVVVGRDGRLSGPDLIG
GLVDGLRATGMDVIDLGMVATPMVYFGTNIELDGVKATSGIMVTGSHNPPDYNGFKMVLA
GKAIYGEQIQGLRQRIEAGNFANGAGAYRQCDVRQQYLDRITSDVKLARPMKIALDAGNG
VAGAFVGDLFRGLGCEVTELFCDVDGNFPNHHPDPAHVENLQDLMKCLHETDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAEEILARNPGAQVIYDVKCTGKLAPWIRAHGGEPL
MWKTGHSLVKAKLKETGAPIAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRHTDPSAV
LNALPNANNTPELQLKCVEGEPFTLLDKIKANARFEGAREVITIDGVRVEYPDGFGLARP
SNTTPVVVMRFEADNDAALARIQAEFKRVILAEKPDAKLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgatcccagcatcttcaaagcctacgacatccgcggcatcgtcggtaagacg
ctgacccgcgatgtggcccgcctgatcggcctgtccttcggctccgcggcggcggaagct
ggcgagaaggccgtagtagtcggccgcgacggccgtctgtcggggcccgacctcattggc
ggcctggtcgatggcctgcgcgccacgggcatggacgtgatcgatctcggcatggtcgcc
acgccgatggtctatttcggcacgaacatcgaactggatggcgtaaaggccacttccggg
atcatggtgaccggcagtcacaatccgcccgactacaacggcttcaagatggtgctggcc
ggcaaggcgatctacggcgagcagattcagggtctgcgccagcgcatcgaggcgggcaac
ttcgccaacggtgcaggtgcctaccgccaatgcgatgtgcgccagcagtaccttgatcgc
atcacgagcgacgtgaagctggcccgcccgatgaagatcgcgctcgacgccggcaacggc
gtggctggcgccttcgtcggtgacctgttccgcggcctgggctgcgaggtgaccgagctg
ttctgcgacgtcgacggcaacttcccgaaccatcaccccgatcctgcccacgtggaaaac
ctgcaggacctgatgaagtgcctgcacgagaccgattgcgagctgggcctggccttcgac
ggcgatggcgaccgcttgggcgtggtgacgaaggacggccaggtcattttcccggaccgc
cagctgatgctgttcgccgaggagatcctcgcccgcaacccgggcgcccaggtcatctac
gacgtcaagtgcaccggcaagctggcaccgtggatccgcgcgcacggcggcgagccgctg
atgtggaagaccggccattcgctggtcaaggcaaagctcaaggaaaccggcgcgccgatc
gccggcgagatgagcggccacgtgttcttcaaggaccgctggtacggctttgacgatggc
ctgtacaccggcgcgcgcctgctcgagatcctgtcacgccataccgatccgagcgccgta
ctgaacgcgctgccgaacgccaacaacacgccggaactgcaactcaagtgcgtggaaggc
gagccgttcacgctgctggacaagatcaaggccaacgccaggttcgagggcgcgcgcgag
gttatcaccatcgatggcgtgcgcgtggagtatcccgatggctttggtctggcacgcccg
tccaacaccacgcccgtggtggtgatgcgtttcgaggctgacaacgacgcagcgctggcc
cgtatccaggctgaattcaagcgtgtgatcctggccgaaaagcctgatgccaagctcccg
ttctga

DBGET integrated database retrieval system