KEGG   Ralstonia eutropha JMP134: Reut_A0751Help
Entry
Reut_A0751        CDS       T00268                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
reu  Ralstonia eutropha JMP134
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(812469..813122)
Genome map
AA seq 217 aa AA seqDB search
MDLEKARFNMIEQQIRPWDVLDQEILDLLAVVKREEFVPAAYKGLAFVDMEIPLPGGQNM
LPPRVEARILQELAVRKHENVLEIGAGSGYMAALLANRARHVLTVDIVPELVTLARQNLA
NAGVTNVDVAEGNAADGWAAAAPYDVICISGSLPAIPQSMLAQIKVGGRIAAFVGSLPVM
EARLVTRLSDTEYQVVNLFETAVKPLVGAAQPSQFRF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgaaaaagcccgattcaacatgatcgaacagcaaatccgcccgtgggacgtg
ctggaccaggaaatcctggacctgctggcggtggtcaagcgcgaggaattcgttcccgcg
gcctacaagggcctggccttcgtcgacatggagattccgctgccgggcggccagaacatg
ctgcccccccgcgtggaagcccgcatcctgcaggaactggccgtgcgcaagcatgagaac
gtgctcgaaatcggcgccggctccggctacatggccgcgctgctggccaaccgcgcacgt
cacgtgctgaccgtggatatcgtgcccgagctcgtgaccctggcccgccagaacctggcc
aatgccggcgtcaccaatgtcgacgtggccgaaggcaacgccgccgacggctgggccgct
gctgccccgtacgacgtgatctgcatctcgggctcgctgccggccatcccgcagtcgatg
ctggcgcagatcaaggtcggtggccgcatcgccgcattcgtcggctcgctgccggtgatg
gaagcgcgcctggtcacgcgcctgtccgacaccgaataccaggtcgtgaatctgttcgag
accgcggtcaagccgctggtcggcgcggcccagccgtcgcaattccggttctga

DBGET integrated database retrieval system