KEGG   Ralstonia eutropha JMP134: Reut_A0862Help
Entry
Reut_A0862        CDS       T00268                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Reut_A0862
   00052 Galactose metabolism
    Reut_A0862
   00500 Starch and sucrose metabolism
    Reut_A0862
   00520 Amino sugar and nucleotide sugar metabolism
    Reut_A0862
Enzymes [BR:reu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Reut_A0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(931737..932633)
Genome map
AA seq 298 aa AA seqDB search
MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGR
SKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECYYVRQPEALGLGHAVLCAA
KLVGEAPFAVMLADDLIDGTPPVMKQMVDLYNHYNCSVLGVEEIAPEQSRSYGVVDGREW
DEGVIKMSGIVEKPAPEDAPSNLGVVGRYILTPRIFDHLRELKPGAGGEFQLTDAIQSLL
SQEQVLAYRYHGTRYDCGSKLGYLKATVEYALKHPEVSAGFRDYLEHRGTYLADGTMA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcgcgttaccaaggccgtcttcccggtcgcgggcctgggcacccgctttctg
cccgccaccaaggccagcccgaaggaaatgctgccagtggtcgacaagcctctgatccag
tacgccgtggaagaagccatggccgccggcatcaccgaaatgatcttcgtcacgggccgc
tccaagcgcgcgatcgaagaccacttcgacaaggccttcgaactggaagtggaactcgag
gcaaagaacaagcaggcgctgctcgacgtggtgcgttcgatcaagccggccaacgtggag
tgctactacgtgcgccagcctgaagcgctgggcctgggccatgccgtactgtgcgccgcc
aagctcgtcggtgaagccccgttcgcggtcatgctggccgatgacctgatcgacggcacg
ccgccggtgatgaagcagatggtggacctgtacaaccactacaactgctcggtgctcggc
gtcgaagagatcgccccggagcagagccgttcatacggcgtggtcgatggccgcgaatgg
gatgaaggcgtgatcaagatgtctggcatcgtggaaaagccggcacccgaagacgcaccg
tccaacctgggcgtggtcggccgctacatcttgacgccgcgcatcttcgaccacctgcgc
gaactgaagccgggcgcgggcggcgagttccagcttaccgacgcgatccagtcactgctc
agccaggagcaggtgctggcgtaccgctaccacggcacgcgctatgactgcggcagcaag
ctcggctacctgaaggccacggtcgagtacgcgctgaagcacccggaagtcagcgctggt
ttccgcgattacctcgaacaccgcggcacctacctcgccgacggcacgatggcctga

DBGET integrated database retrieval system