KEGG   Ralstonia eutropha JMP134: Reut_A0914Help
Entry
Reut_A0914        CDS       T00268                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
reu  Ralstonia eutropha JMP134
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Reut_A0914
   00670 One carbon pool by folate
    Reut_A0914
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Reut_A0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(994661..995161)
Genome map
AA seq 166 aa AA seqDB search
MTLLTLVVARARNGTIGRNNTLPWRLPEDLAHFKRTTMGAPIIMGRKTWDSIGRPLPGRR
NIVVSRNADLKLQGAEVATSLEDAQRLCVGVEQVFLIGGAQLYAEALPSADRLVVTEIDA
DVEGDAFFPAIDQAKWIETSRETHHSEANGFDYAFVTYDRPPSGEE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgctgactctcgtcgtcgcacgtgcccgcaatggcaccatcggccgcaacaac
acgctgccctggcggttgcccgaagacctcgcgcatttcaagcggactaccatgggcgcg
ccgatcatcatgggtcgcaagacctgggattcgattggccggccattgcctgggcggcgc
aatattgtcgtaagccgcaacgcggatctgaaactgcaaggcgcggaagttgccacctcg
ctggaagatgcgcaaaggctctgcgtaggcgtcgaacaggtgtttctgatcggcggtgcg
cagctctatgccgaagcgctgcccagtgcggatcggctagtcgtgacggagattgatgcg
gatgtagagggcgatgccttcttccccgccatcgatcaggcgaaatggatcgagacgtcg
cgtgaaacgcatcattcggaagccaatggctttgactatgcgttcgtgacgtatgatcgg
ccgccttccggggaagagtaa

DBGET integrated database retrieval system