KEGG   Ralstonia eutropha JMP134: Reut_A0959Help
Entry
Reut_A0959        CDS       T00268                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Reut_A0959 (tpiA)
   01230 Biosynthesis of amino acids
    Reut_A0959 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_A0959 (tpiA)
   00051 Fructose and mannose metabolism
    Reut_A0959 (tpiA)
   00562 Inositol phosphate metabolism
    Reut_A0959 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Reut_A0959 (tpiA)
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Reut_A0959 (tpiA)
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Reut_A0959 (tpiA)
  Exosomal proteins of bladder cancer cells
   Reut_A0959 (tpiA)
  Exosomal proteins of melanoma cells
   Reut_A0959 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1047775..1048512
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAAPARARLAVCAPFPYLAQCQALLNGSQVAWGA
QDVSAEARGAFTGEVAASMLGEFGCTYALVGHSERRTYHGESDAVVAAKALRALEFGIIP
VICVGETLAQREAGETEVVVGRQLQAALDALSVEQLGRVVLAYEPVWAIGTGKTASSEQA
QAVHAFLRAEVRERDAGVADRMAILYGGSVKPDNAAELFSMSDIDGGLIGGASLKSEDFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaactggaagatgcacggcagcctggcagccaacgct
gcgctgctggaaggtatcaaggctgcacctgcgcgcgcgcggttggcagtctgcgcgcct
ttcccttatcttgcacagtgccaggcgttgctgaatggctcgcaggtagcctggggcgca
caagatgtgtccgccgaggcccgtggcgcgttcaccggcgaggtggccgcgtcgatgctg
ggtgagttcggctgcacgtacgcgctggtcggacactcggagcgccgcacgtaccatggg
gaatccgatgccgtggtagctgccaaagcgctgcgcgcgctggaattcggcatcattccg
gtgatttgcgtcggtgaaacgctcgcccagcgcgaggccggtgaaaccgaagttgtcgtc
ggtcgtcaattgcaggccgctctcgacgcgctgtcggtggagcaactgggtcgtgtggtg
ctggcctacgaaccggtgtgggccatcggtactggcaagaccgcaagcagcgagcaggcg
caggccgtgcatgcgttcttgcgtgcagaggtgcgcgagcgcgacgccggtgtggctgac
cgtatggcgattttgtacggtggcagtgtcaagccggacaatgcggccgaattgttttcc
atgtccgatatcgacgggggcctgattgggggtgcctcgctgaagtcggaagattttctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system