KEGG   Ralstonia eutropha JMP134: Reut_A1384Help
Entry
Reut_A1384        CDS       T00268                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Reut_A1384
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Reut_A1384
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Reut_A1384
Lipid biosynthesis proteins [BR:reu01004]
 Fatty acid synthase
  Component type
   Reut_A1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1495198..1495803)
Genome map
AA seq 201 aa AA seqDB search
MAFMVTAAGATAQAAPAVLVLGDSLSAEYGIARGSGWVSLLQQRLQKERLDYSVVNASIS
GETTIGGKTRLPDLLARHRPAVVIVELGANDALRGLSLQVTESNLRTIVGGAQKAGARVL
LIGMRIPPNYGQDYTEKFFALYPRLAQEFKAPLVPFFLDKVITRQDWFQPDRIHPTADAQ
PALLDTVWPHLKPLLRAGGKG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggccttcatggtgacggcggcaggtgccaccgcgcaggcggcacctgccgtactggta
cttggcgacagcctgtcggccgagtacggcattgcacgcggctctggctgggtcagcctg
ctgcagcagcgcttgcagaaagagcgtctcgattatagcgtcgtcaacgcgagcatcagc
ggagagaccacgatcggcggcaagacgcgattgcctgacttgctggctcggcatcggccg
gccgtggtgatcgtggaactgggagccaatgacgccttgcgcggcctctcgctccaggtg
accgaatcgaatttgcgtaccatcgttggcggtgcccagaaagccggcgcgcgcgtgctg
ctgattggcatgcgtatcccgcctaactatggccaggactacaccgaaaagttcttcgcg
ctctatccgcgactggcacaggaattcaaggcgccgctggtaccgttcttcctcgacaag
gtcatcacacgccaggactggttccagcccgatcgaatccatccaacggccgacgcacag
ccagccctgctggacactgtgtggcctcacctcaagcccttgctcagggccggcggcaaa
ggctga

DBGET integrated database retrieval system