KEGG   Ralstonia eutropha JMP134: Reut_A1667Help
Entry
Reut_A1667        CDS       T00268                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00281  Geraniol degradation
reu00310  Lysine degradation
reu00360  Phenylalanine metabolism
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00410  beta-Alanine metabolism
reu00627  Aminobenzoate degradation
reu00640  Propanoate metabolism
reu00650  Butanoate metabolism
reu00903  Limonene and pinene degradation
reu00930  Caprolactam degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01212  Fatty acid metabolism
Module
reu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Reut_A1667
   00650 Butanoate metabolism
    Reut_A1667
  Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1667
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1667
   00310 Lysine degradation
    Reut_A1667
   00360 Phenylalanine metabolism
    Reut_A1667
   00380 Tryptophan metabolism
    Reut_A1667
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Reut_A1667
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Reut_A1667
   00281 Geraniol degradation
    Reut_A1667
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1667
   00627 Aminobenzoate degradation
    Reut_A1667
   00930 Caprolactam degradation
    Reut_A1667
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Reut_A1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AAZ61033
UniProt: Q471A0
Position
1:complement(1799352..1800116)
Genome map
AA seq 254 aa AA seqDB search
MSDTLQLETRGNILLITMNRPEARNAMDFETATALAAALDQLESRDDLSVAILTGAGGTF
CSGMDLKGFLAGKRPSLPGRGFGGLTEAQPRKVLIAAVEGYALAGGFEMALACDLIVASK
AAKFGLPEVKRGLVAAAGGLMRLPSRIPYHIAMEYALTGNMLGAEQAHTYGLVNRLTEPG
QALEAAIALAEEVGANGPMAVAVSKQIVSESADWSAAEMFERQRPLVAPVFTSSDAREGA
AAFAEKRKPVWTGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgctgcaacttgaaacgcgcggcaatatcctgctgatcacgatgaaccgg
cccgaggcgcgcaacgccatggacttcgagactgcgacggcgctggccgccgcgctcgac
cagctcgagtcgcgcgacgacctgagcgtggccatcctgaccggtgcgggcggtaccttc
tgctccggcatggacctgaagggcttcctggccggcaagcgccccagcctgccgggccgc
ggctttggcggcctgaccgaagcgcagccgcgcaaggtactgatcgccgcggtggaaggc
tatgcactggccggtggctttgaaatggcgctggcctgtgacctgatcgtggcctcgaag
gcggccaagttcggcctgcccgaagtcaagcgcggcctggtggctgccgctggcggcctg
atgcgcctgccgagccggatcccgtaccacatcgccatggaatacgcgctgaccggcaat
atgctcggcgccgaacaggcgcatacgtacgggctggtcaatcgcctgaccgagccgggc
caggcactggaagccgcgatcgcgctggccgaggaagtcggtgccaatggtccgatggcc
gtggcggtcagcaagcagatcgtcagcgagtccgctgactggtcggcggccgagatgttc
gagcgccagcgtccgcttgtcgccccggtgttcacgtcatccgatgcccgcgagggcgcc
gctgcgtttgccgagaagcgcaaacctgtgtggaccggcaagtaa

DBGET integrated database retrieval system