KEGG   Ralstonia eutropha JMP134: Reut_A1895Help
Entry
Reut_A1895        CDS       T00268                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Reut_A1895
  Amino acid metabolism
   00300 Lysine biosynthesis
    Reut_A1895
Enzymes [BR:reu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Reut_A1895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2077553..2078704
Genome map
AA seq 383 aa AA seqDB search
MTATLALTEDLIRRRSVTPADEGCQAVLETRLKALGFTCEAIVSGPDDFRVTNLWAVKRG
TQGTDGKLLAFAGHTDVVPTGPLEQWNSDPFEPTHRDGRLYGRGAADMKTSIAGFVVAVE
EFVKAHPAHAGSIAFLITSDEEGPAHDGTIKVVEALKARGERLDYCVIGEPTSVDTLGDM
VKNGRRGSLSGKLVVKGVQCHIAYPHLGRNPIHEAAPALAELAAEVWDQGNEYFPPTSWQ
MSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKSRVHAILDKHKLEYTLDWTLGGEP
FLTPRGDLSDALSAAIEAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPNATIHKIDE
NVEVRFIDPLKNVYRGVLERLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacccttgccctcaccgaagacctgatccgccgccgctccgtcacgcccgcg
gacgaaggctgccaggccgtgctggaaacgcgcctgaaggcgctcggcttcacgtgcgaa
gccattgtcagcggccccgacgatttccgcgtgaccaacctgtgggccgtgaagcgcggc
acgcaaggcacggacggcaagctgctggcctttgccggtcacaccgacgtggtgccgacc
ggcccgctcgaacaatggaactcggacccgttcgagccgacgcaccgtgacggtcgcctg
tatggccgtggcgcagcggacatgaagacgtcgatcgccggctttgtcgtggcggtcgag
gaattcgtcaaggcgcatccggcccatgcgggctcgatcgcgttcctgatcaccagcgac
gaggaaggcccggcgcacgacggtaccatcaaggtcgtcgaagcgctgaaggcgcgcggc
gaacgcctggactactgcgtgatcggcgaacccacgtcggtcgacacgctcggcgacatg
gtcaagaacggccgccgtggctcgctgtcgggcaagctcgtcgtcaagggcgtgcagtgc
catatcgcctacccgcacctgggccgcaacccgatccacgaagccgcgcccgcgctggcc
gagctggctgccgaggtatgggaccagggcaacgagtacttcccgccgacgagctggcag
atgtcgaacatccacggcggcaccggcgcgaccaacgtcatcccgggccacgtcacgatc
gacttcaacttccgcttctcgaccgcaagcacgcccgaaggcctcaagtcccgcgtgcat
gcgatcctggacaagcacaagctcgaatacacgctggactggacgctcggcggcgagccg
ttcctgaccccgcgcggcgacctgtccgatgcgctgtcggccgccatcgaggccgagacc
ggcgtcaagaccgaactgtcgaccacgggcggcacatccgatggccgcttcatcgccaag
atctgcccgcaagtgatcgagttcgggccgcccaacgcgaccatccacaagatcgacgag
aacgtcgaagtccgctttatcgatccgctcaagaacgtctatcgcggcgtgctcgaacgg
ctcattgcctga

DBGET integrated database retrieval system