KEGG   Ralstonia eutropha JMP134: Reut_A1961Help
Entry
Reut_A1961        CDS       T00268                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Reut_A1961
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1961
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Reut_A1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2147171..2148466)
Genome map
AA seq 431 aa AA seqDB search
MNREQQIQALQKDWDTNPRWKGIKRNFTAEDVVRLRGSVQVEHTLARRGSEKLWNLLHTE
PFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVKR
INNTFQRADQIQWSEGSGDTDFFAPIVADAEAGFGGVLNAFELMKSMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAVAKLTAARLAADVSGVPTLVIARTDAEAADLLTSDVDDN
DKPFCTGERTVEGFYRVRNGLEQSISRALAYAEVADLVWCETGKPDLEFAKKFAEAVHAK
FPGKMLAYNCSPSFNWKKNLDDATIARFQRELGAMGYKFQFITLAGFHSLNYSMFNLAYG
YARNQMSAFVELQEAEFKAAEKGFTAVKHQREVGTGYFDAVTQAIEGGQSSTTALKGSTE
DEQFFEDKKVA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgaacaacaaatccaggctctgcaaaaggattgggataccaatccacgctgg
aagggcatcaagcgcaacttcacggctgaagacgtagtgcgcctgcgcggttcggtccag
gtggagcacacgctggcacgccgcggttccgagaaactgtggaacttgctgcatacagag
ccgttcgtgaactcgctgggcgcactgaccggcaatcaggccatgcagcaagtcaaggcc
ggcctgaaggccatttacctgtcgggctggcaagtcgctggcgatgccaatctcgccggc
gagatgtacccggaccagtcgctgtatccggccaactcggtgccgcaggtcgtcaagcgc
atcaacaacacgttccagcgcgccgaccagatccagtggagcgagggctcgggcgacacc
gatttcttcgccccgatcgtggctgacgcagaagccggcttcggcggtgtgctgaacgcg
ttcgaactgatgaagtcgatgatcgaagcgggcgcagccggcgtgcacttcgaagaccag
ctcgcttcggtgaagaagtgcgggcacatgggtggcaaggtactggtcccgactcgggaa
gccgtggccaagctgaccgcggcgcgtctggctgccgacgtgtcgggcgttccgacattg
gtgattgctcgtaccgatgccgaagctgctgacctgcttacctcggacgtagacgacaac
gacaagccgttctgcactggcgagcgcactgtggaaggcttctatcgcgtccgcaacggc
ctggagcagtcgatctcgcgggccctggcctacgctgaagttgctgatctggtgtggtgc
gaaaccggcaagccggacctcgagttcgccaagaagtttgccgaagccgtgcacgccaag
ttcccgggcaagatgctggcctacaactgctcgccgtcgttcaactggaagaagaacctc
gacgacgcgaccatcgccaggttccaaagggagttgggcgcgatgggctacaagttccag
ttcatcacactggccggtttccactcgctgaactactcgatgtttaacctggcctacggc
tacgcccgcaaccagatgagcgcgttcgtggaactgcaggaagccgagttcaaggcagcc
gagaaaggcttcaccgccgtgaagcaccagcgcgaagtcggcaccggctatttcgacgcc
gtgacacaggcgatcgaaggcggccagtcatcgacaaccgcattgaagggatctaccgaa
gacgagcagttcttcgaagacaagaaagtggcctga

DBGET integrated database retrieval system