KEGG   Ralstonia eutropha JMP134: Reut_A2169Help
Entry
Reut_A2169        CDS       T00268                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Reut_A2169
Enzymes [BR:reu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Reut_A2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2392433..2393383)
Genome map
AA seq 316 aa AA seqDB search
MPLAPAFSFLRGACADLLFLFPASTLQQTSPSTYFQCGRFRFALDRRPLVMGILNVTPDS
FSDGGMHATRDAALRHAEQLIAEGVDIIDIGGESSRPGSDALPLDEELARVIPIVEALRD
CGKPLSIDTYKPEVMRASLAAGADLINDIWGFRMPGAVEAVAQGQAGLCVMHMQRDPQTM
QEDPQYTDVVAEVAAFLDERVAVLRQAGVDTARITLDPGFGFGKTPDHNLRLLGQLPALA
KARLPLLVGLSRKSTLGAILGGRPPLQRVAASIAAAVCAAERGAYIVRVHDVQDTVDALK
TWWAVRNEAVTGVERQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgcccttggcaccggctttttcgtttctgcgcggagcgtgcgcagatcttctatttttg
tttccggcttctaccttgcagcagacttcgccatccacgtatttccagtgcggccgcttt
cgctttgcgctggaccgccgcccgcttgtcatgggcattctcaacgtaacgcctgattca
ttctccgatggcggcatgcatgccacccgggacgctgccctgcggcacgccgagcagctc
atcgcagaaggtgtggacatcatcgatatcggtggcgagtcgagccgtccgggttccgac
gcattgccgctggatgaagagttggcccgcgtgattcccatcgtcgaggcgctgcgcgat
tgcggcaagccgctatcgatcgatacctacaagccggaggtcatgcgcgcatcgctcgcg
gccggtgcagatctcatcaacgatatctggggcttccgcatgcccggcgccgtcgaggcg
gtggcgcaggggcaggccggtctgtgtgtgatgcacatgcagcgggacccgcagacaatg
caggaggacccgcagtacaccgatgtggtggccgaggtcgctgctttcctcgatgaacgc
gtggccgtgctgcgccaggctggcgtcgacacggcccgcatcacgctcgacccgggattt
ggcttcggcaagactccggatcataatttgcgcctgcttgggcaattgccagcccttgcg
aaagccaggctgcctttgctggtgggcctgtcccgcaagtcaacgcttggcgcgatcctg
ggtggccggccgccgctgcagcgtgtggcggccagcattgccgcagcggtatgtgcggca
gagcgcggagcgtatatcgtgcgcgtgcatgatgtgcaggatacggtggatgccctcaag
acctggtgggcagtccggaatgaagccgtgacaggagtggaacggcagtag

DBGET integrated database retrieval system