KEGG   Ralstonia eutropha JMP134: Reut_A2213Help
Entry
Reut_A2213        CDS       T00268                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Reut_A2213
Enzymes [BR:reu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Reut_A2213
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2446046..2447596
Genome map
AA seq 516 aa AA seqDB search
MNQQTTQAAQQQFVLALDQGTSSSRAILFDHAGNVVRLAQREFRQYYPHPGHVEHDPYEI
WQTQLAVAHEVLNDAGISASQLRAIGITNQRETTVLWDRKTGEPVGRALVWQDRRTAPMC
EALQAAGHAGMIRDKTGLVIDAYFSGTKLRWMLDNVKGARERAQRGELAFGTIDSWLIWQ
LTDGARHVTDVSNASRTMLFNIHSFAWDDALLALLDIPHKVLPEVVPSSGQVARTVPRLF
GAEVPIAGIAGDQQAATFGQACLSPGMAKNTYGTGCFLLMNTGPQPVVSRNRLLTTVGWQ
INGQTQYCLEGGVFMGGATIQWLRDGLKIIASAPEVEPLARQCTDTGGVVLVPAFAGLGA
PHWDAFARGTLVGMTRGTGRPQIARAALESIALQSVDVLDAMQKDAGISLAELRVDGGAS
RSDLLMQMQADLLGTTVVRPRITETTALGAAYLAGLATGYWSDQEQISRQWQVQQRFEPN
LSADERAHRLSRWHRAVERARDWAREDHEATSGKRT
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcagaccacgcaggccgcgcagcagcagttcgtactggcgctggaccagggc
acgagcagttcgcgggccattctgttcgaccacgccggcaatgtggtacggcttgcccag
cgcgaattccgccaatattacccacatcccggccacgtcgagcacgacccgtacgaaatc
tggcagacgcagctcgcggtcgcgcacgaggtcctgaacgacgcgggtatctcggcctcg
cagttgcgcgcaatcggcatcacgaaccaacgcgaaaccacggtcctgtgggaccgcaag
accggcgagcccgtgggccgcgcgctggtctggcaagaccgccgcaccgcgcccatgtgc
gaggcactgcaggcggccggccatgccggcatgatccgcgacaagaccgggctcgtcatc
gatgcctacttctccggcaccaagctgcgctggatgctcgacaacgtcaagggcgcgcgc
gaacgcgcccagcgcggcgaactggcgttcggcacgatcgacagctggctgatctggcag
ctcaccgacggcgcgcgccatgtgaccgacgtgtccaacgcttcgcgcacgatgctgttc
aatatccacagcttcgcatgggacgatgcgctactcgcattgctggacatcccgcacaag
gtgctgccggaggtggtgccctccagtggccaggtcgcgcgcacggtgccgcggctgttt
ggcgcggaagtccctattgccggcatcgcgggcgaccagcaggccgccacgttcggccag
gcctgcctgtctccgggcatggccaagaacacgtatggcacgggttgcttcctgctgatg
aatacggggccgcagccggtggtctcgcgcaaccgcttgctgacgacggtcggatggcag
atcaacgggcagacgcaatactgcctggaaggcggtgtctttatgggcggcgccacgatc
cagtggctgcgcgatggcctgaagatcatcgcaagcgccccggaggtcgagccactcgcg
cgccagtgcacggacacgggcggtgtggtgctggtgccggcctttgccggcctcggcgcg
ccgcactgggatgcattcgcacgcggcacgctggtcggtatgacgcgcggcaccggccgc
ccgcagatcgcacgcgcggcgctggaatcgattgcgctgcagagcgtggacgtgctcgat
gccatgcagaaggacgccggcatttcgctcgcggaacttcgcgtagacggcggcgcgtcg
cgcagcgacctgctgatgcagatgcaggccgacctgctcggcacgaccgtggtacgtccg
cgcatcaccgaaacgacggcactgggcgcagcctacctggccggcctcgccaccgggtac
tggagcgaccaggagcagatttcccggcaatggcaggtgcagcagcgcttcgagcccaac
ctgtccgccgatgaacgcgcgcaccggctgtcgcgctggcaccgcgccgtggaacgggcc
cgcgactgggcccgggaagatcacgaggccaccagcggcaagagaacgtga

DBGET integrated database retrieval system