KEGG   Ralstonia eutropha JMP134: Reut_A2304Help
Entry
Reut_A2304        CDS       T00268                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00260  Glycine, serine and threonine metabolism
reu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01130  Biosynthesis of antibiotics
reu01230  Biosynthesis of amino acids
Module
reu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Reut_A2304
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Reut_A2304
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Reut_A2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth PcrB HTH_28
Motif
Other DBs
NCBI-ProteinID: AAZ61666
UniProt: Q46YW7
Position
1:complement(2541050..2541847)
Genome map
AA seq 265 aa AA seqDB search
MSRIQKTFAALAAQNKKGLIPFITAGDPEPGLTVDLMHALVAGGADVIELGVPFSDPMAD
GPVIQRASERALANGVSLTQVLQWVREFRQTNADTPVVLMGYANPIERMGEAAFAKAAGA
AGVDGVLVVDYPPEECESFAVLMRDNGIDPIFLLAPTSTDARIEAVGKVASGYVYYVSLK
GVTGSATLDLDSVAARLPLIKKHVNLPVGVGFGIRDAQTARAIGSVADAVVIGSRLVQLL
EDAPRGQAVESLRAFIAGIREALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcatccagaagacattcgcggcactcgccgcgcagaacaagaagggcctgatt
ccgttcattaccgcaggcgacccggaaccggggctgacggtggacctgatgcacgcactc
gttgccggcggcgccgacgtgatcgagctcggcgtgccgttctccgatccgatggccgat
ggcccggtgatccagcgcgcctccgagcgcgcgctcgccaatggcgtgtcgctcacgcag
gtgctgcagtgggtgcgtgaattccgccagaccaatgccgatacgccggtcgtgctgatg
ggctatgccaacccgatcgagcgcatgggcgaggccgcatttgccaaggccgctggtgct
gctggcgtggacggcgtgctcgtggtcgactatccgccggaagagtgcgagtcgttcgcc
gtgctgatgcgcgacaacggcatcgatccgatcttcctgctggcgccgacttcgacggat
gcgcgcatcgaggccgttggcaaggtggcgagcggctatgtctactacgtctcgctcaag
ggcgtgaccggttcggccacgctggatctcgacagtgtcgcggcacgcctcccactgatc
aagaagcacgtgaacctgcctgttggcgtgggctttggcatccgtgatgcgcagacggca
cgcgcgatcggcagcgtggcggacgccgtggtgatcggtagccggctggtgcagctgctc
gaagatgcgccgcgcggacaggcggtagaatcgctgcgtgcgttcatcgccggaattcgc
gaggcgctggacgcctga

DBGET integrated database retrieval system