KEGG   Ralstonia eutropha JMP134: Reut_A2304Help
Entry
Reut_A2304        CDS       T00268                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Reut_A2304
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Reut_A2304
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Reut_A2304
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Reut_A2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2541050..2541847)
Genome map
AA seq 265 aa AA seqDB search
MSRIQKTFAALAAQNKKGLIPFITAGDPEPGLTVDLMHALVAGGADVIELGVPFSDPMAD
GPVIQRASERALANGVSLTQVLQWVREFRQTNADTPVVLMGYANPIERMGEAAFAKAAGA
AGVDGVLVVDYPPEECESFAVLMRDNGIDPIFLLAPTSTDARIEAVGKVASGYVYYVSLK
GVTGSATLDLDSVAARLPLIKKHVNLPVGVGFGIRDAQTARAIGSVADAVVIGSRLVQLL
EDAPRGQAVESLRAFIAGIREALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcatccagaagacattcgcggcactcgccgcgcagaacaagaagggcctgatt
ccgttcattaccgcaggcgacccggaaccggggctgacggtggacctgatgcacgcactc
gttgccggcggcgccgacgtgatcgagctcggcgtgccgttctccgatccgatggccgat
ggcccggtgatccagcgcgcctccgagcgcgcgctcgccaatggcgtgtcgctcacgcag
gtgctgcagtgggtgcgtgaattccgccagaccaatgccgatacgccggtcgtgctgatg
ggctatgccaacccgatcgagcgcatgggcgaggccgcatttgccaaggccgctggtgct
gctggcgtggacggcgtgctcgtggtcgactatccgccggaagagtgcgagtcgttcgcc
gtgctgatgcgcgacaacggcatcgatccgatcttcctgctggcgccgacttcgacggat
gcgcgcatcgaggccgttggcaaggtggcgagcggctatgtctactacgtctcgctcaag
ggcgtgaccggttcggccacgctggatctcgacagtgtcgcggcacgcctcccactgatc
aagaagcacgtgaacctgcctgttggcgtgggctttggcatccgtgatgcgcagacggca
cgcgcgatcggcagcgtggcggacgccgtggtgatcggtagccggctggtgcagctgctc
gaagatgcgccgcgcggacaggcggtagaatcgctgcgtgcgttcatcgccggaattcgc
gaggcgctggacgcctga

DBGET integrated database retrieval system