KEGG   Ralstonia eutropha JMP134: Reut_A2324Help
Entry
Reut_A2324        CDS       T00268                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00190  Oxidative phosphorylation
reu00650  Butanoate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01200  Carbon metabolism
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
reu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A2324
   00650 Butanoate metabolism
    Reut_A2324
  Energy metabolism
   00190 Oxidative phosphorylation
    Reut_A2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C Fumarate_red_D CybS DUF3754
Motif
Other DBs
NCBI-ProteinID: AAZ61686
UniProt: Q46YU7
Position
1:complement(2563659..2564024)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVILAIAFLLSNGASYEAWAGLFSN
QWMKIITFLTILSLLYHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaacaataatatcggtcccaagcgtcttgtcgtcggtgcccactacggcctgaaa
gactggctcgcgcaacgcgtcacggctgtgatcatggtggtgttcaccgtgatcctggct
attgccttcctgctgtcgaacggcgcttcgtacgaagcgtgggcagggctcttctccaac
cagtggatgaagatcatcacgttcctgaccatcctgtcgctgctgtatcacgcctggatc
ggcgtacgtgacatctggatggactatgtgaagccgatggccgtgcgcctcgtgctgcaa
gttcttacgattctgtggctcgtcggttgtgcgggctacgctgctcagattctctggagg
gtgtaa

DBGET integrated database retrieval system