KEGG   Ralstonia eutropha JMP134: Reut_A2324Help
Entry
Reut_A2324        CDS       T00268                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
reu  Ralstonia eutropha JMP134
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Reut_A2324
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A2324
   00650 Butanoate metabolism
    Reut_A2324
  Energy metabolism
   00190 Oxidative phosphorylation
    Reut_A2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2563659..2564024)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVILAIAFLLSNGASYEAWAGLFSN
QWMKIITFLTILSLLYHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaacaataatatcggtcccaagcgtcttgtcgtcggtgcccactacggcctgaaa
gactggctcgcgcaacgcgtcacggctgtgatcatggtggtgttcaccgtgatcctggct
attgccttcctgctgtcgaacggcgcttcgtacgaagcgtgggcagggctcttctccaac
cagtggatgaagatcatcacgttcctgaccatcctgtcgctgctgtatcacgcctggatc
ggcgtacgtgacatctggatggactatgtgaagccgatggccgtgcgcctcgtgctgcaa
gttcttacgattctgtggctcgtcggttgtgcgggctacgctgctcagattctctggagg
gtgtaa

DBGET integrated database retrieval system