KEGG   Ralstonia eutropha JMP134: Reut_A2473Help
Entry
Reut_A2473        CDS       T00268                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Reut_A2473 (gmk)
Enzymes [BR:reu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Reut_A2473 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2713555..2714205)
Genome map
AA seq 216 aa AA seqDB search
MSDTPHTAIDTVYPGNLFMVVAPSGAGKSTLVNALLAQDAAIRLSISHTTRAPRPGEQDG
REYHFCTVDSFRAARDRGEFLEWAEVHGNYYATSRVWIEEQMAQGNDVLLEIDWQGAQQV
HQRFSNAVEIFILPPSLTALEDRLKKRGQDEPNVIVRRLLAAGSEMSHASESDYVIINEV
FDNALEELRNVVRATRLRFSSQKARHTELFIELGIH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacgcctcacaccgccatcgataccgtctaccccggcaacctgttcatggtg
gtggcaccttccggagccggcaagtcgacgctggtcaacgcgctgctcgcgcaggacgcg
gcgatccgcctgtcgatctcccataccacgcgtgcgccgcgccccggcgaacaggatggg
cgcgagtatcacttctgcacagtggactccttccgcgctgcgcgcgaccgcggcgagttc
ctcgagtgggccgaggtccacggcaattactacgcgacgtcgcgcgtgtggatcgaggag
cagatggcgcagggcaatgacgtgctgctcgagatcgactggcagggcgcgcaacaggtg
caccagcggttctcgaacgcggtcgagatcttcatcctgccgccgtcgctgactgcgctg
gaagaccgcctgaagaagcgtggccaggacgagcccaacgtgatcgtgcggcgcctgctg
gcggctggcagcgagatgtcgcatgcgtccgaatcggactacgtcatcatcaacgaggtc
ttcgacaacgcgctcgaggaactgcgcaacgtggtgcgtgccacgcgcctgcgcttttcg
tcgcaaaaagcgcgccataccgagctcttcatcgagcttggcattcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system