KEGG   Ralstonia eutropha JMP134: Reut_A2738Help
Entry
Reut_A2738        CDS       T00268                                 

Definition
Fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Reut_A2738
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Reut_A2738
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Reut_A2738
Lipid biosynthesis proteins [BR:reu01004]
 Desaturase
  First
   Reut_A2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3004431..3005621)
Genome map
AA seq 396 aa AA seqDB search
MFDTILDWAANGLANWSWWEIVIYTLVVTHITIAGVTIFLHRCMAHRSLDLHPIAQHFFR
FWLWLTTGMVTREWTAIHRKHHAKCETEDDPHSPQTRGIRKVLLEGAELYRAEAKNKETI
AKFGHGCPNDWVERNVYSRFGWQGVGLMLIIDLALFGVIGMTVWAVQMLWIPINAAGVIN
GLGHWWGYRNYDCEDASTNVSPWGLVIGGEELHNNHHTYPTSAKFSIKWYEFDVGWGYIR
AMQAVGLAKVKKTPPKARLVEARPVDENTLEAIIANRYDVMARYAKAVKSAFRQELEQLK
EGRVAEYRTFKPASKWFHREEAKLAAPQRQQLASIVEQSKSLHTFVEMRRELAAIWGRSN
LTREQLLQQLQAWCHRAEASGIQALHDFSLRLRRYA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgacactattcttgactgggccgcgaatggccttgccaactggtcctggtgggag
atcgtgatctacacgctggtggtgacgcacatcaccatcgcgggcgtcaccatcttcctg
catcggtgcatggcgcaccgctcgctggacttgcacccgattgcccagcatttcttccgc
ttctggctctggctgaccacgggcatggtcacgcgcgagtggaccgcgatccaccgcaag
caccacgccaaatgcgagaccgaggatgatccgcacagcccgcagacccgtggcatccgc
aaggtgctgctggaaggcgccgagctgtaccgcgccgaggccaagaacaaggaaaccatc
gccaagttcggccatggctgcccgaacgactgggtcgagcgcaatgtgtactcgcgcttc
ggctggcagggcgtcggcctgatgctgatcatcgacctggcgctgttcggcgtgatcggc
atgaccgtctgggccgtgcagatgctgtggatccccatcaacgctgccggcgtcatcaac
ggcctgggccactggtggggctaccgcaactacgattgcgaggatgcatcgaccaatgtc
tcgccgtggggcctggtcatcggtggcgaagagctgcacaacaaccaccacacgtacccg
acttcggcgaagttttcgatcaagtggtacgagttcgatgtgggttggggttatatccgc
gcgatgcaagccgtaggcctcgccaaggtgaagaagacgccgcccaaggctcgcctggtg
gaagcgcgcccggtcgacgagaacacgctggaagcgatcatcgccaaccgctatgacgta
atggcacgctacgccaaggccgtgaagagcgcgttccgccaagagctggaacaactgaag
gaaggccgcgttgccgagtaccgcacgttcaagccggccagcaagtggttccaccgcgaa
gaggccaagctggccgcgccgcagcgccagcagctcgcgagcatcgtcgagcagagcaag
tcgctgcacacgttcgtggaaatgcgacgtgaactggccgccatctggggccgttcgaac
ctgacgcgcgagcagctgctgcagcagctgcaggcctggtgccatcgtgccgaggctagt
ggtatccaggcgctgcacgatttttcgctgcgcctgcgccgctacgcctga

DBGET integrated database retrieval system