KEGG   Ralstonia eutropha JMP134: Reut_A2778Help
Entry
Reut_A2778        CDS       T00268                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Reut_A2778
Enzymes [BR:reu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Reut_A2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3047365..3047901
Genome map
AA seq 178 aa AA seqDB search
MTLAFIGIGANLGDARQALKDAIVCLAQQVGITVLARSSLYRTAPVDADGDDYYNAVVKV
QTSFTAAQLLRICHHIEDQFGRERPFRNAPRTLDLDLLVFGDEQHNHEHLTVPHPRVTER
AFTLVPLLELAPELVIPGVGPAVDFLARVGGQRIDKVSTCKCMRAQAAGSAGPSDAKD
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgccttcatcggcattggtgccaacctgggcgatgcccgccaggcactgaaa
gacgcgatcgtatgcctggctcagcaggtcggcattacggtactggcacggtcttcgctg
tatcggaccgcgcccgtcgatgccgatggcgacgattactacaacgcggtggtcaaggtg
cagacctcgttcacggccgcgcagctgcttcgcatctgccaccacatcgaagaccagttt
ggccgcgaacgcccgttccgcaacgcgccgcgcacgctggacctggacctgcttgtgttc
ggtgacgaacagcacaaccacgagcatctgacggtaccgcatccgcgcgtcaccgagcgc
gcctttacgctggtgccgctgctggagctggcccccgaactggtgattcccggcgtcggc
cccgccgtcgactttctcgctcgggttggcggccagcgcatcgataaagtctccacctgc
aagtgcatgcgcgcgcaggccgccggttcagccggcccctccgacgctaaggactga

DBGET integrated database retrieval system