KEGG   Ralstonia eutropha JMP134: Reut_A2798Help
Entry
Reut_A2798        CDS       T00268                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Reut_A2798
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Reut_A2798
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Reut_A2798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3067521..3068015)
Genome map
AA seq 164 aa AA seqDB search
MSNVYQFEAKSLAGQPVPLSQFRGKVLLIVNTASECGFTPQYAGLQALHDAYAARGLEVL
GFPCNQFGKQEPGDAQQIGQFCESRFSVKFPMFAKIDVKGPDAHPLYQWLTSAKRGVLGT
QAIKWNFTKFLLRRDGTVYKRYGSITKPEEIRADIETLLADPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtctaccagttcgaagccaagtccctcgcggggcagcccgtgccgctgtcg
cagttccgcggcaaggtactgctgatcgtcaacaccgccagcgaatgcggctttacgccg
cagtacgcgggcctgcaggccctgcacgacgcgtacgccgcgcgcggactcgaagtgctg
ggattcccgtgcaaccagttcggcaagcaggagccaggcgacgcgcagcagatcggccag
ttctgcgaatcgcgcttcagcgtcaagtttccgatgttcgccaagatcgacgtgaagggg
cctgacgcgcacccgctataccaatggctcaccagcgcgaagcgcggcgtgctcggcacg
caggcaatcaagtggaatttcaccaagttcctgctgcgccgtgacggcacggtctacaag
cgctacgggtcgatcaccaagccggaagagatccgcgcggatatcgaaacgctgctggcc
gatccggctgcctga

DBGET integrated database retrieval system